KEGG   Miniopterus natalensis: 107540752
Entry
107540752         CDS       T05883                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107540752 (GNAI1)
   04371 Apelin signaling pathway
    107540752 (GNAI1)
   04071 Sphingolipid signaling pathway
    107540752 (GNAI1)
   04024 cAMP signaling pathway
    107540752 (GNAI1)
   04022 cGMP-PKG signaling pathway
    107540752 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107540752 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107540752 (GNAI1)
   04670 Leukocyte transendothelial migration
    107540752 (GNAI1)
   04062 Chemokine signaling pathway
    107540752 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107540752 (GNAI1)
   04915 Estrogen signaling pathway
    107540752 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    107540752 (GNAI1)
   04921 Oxytocin signaling pathway
    107540752 (GNAI1)
   04926 Relaxin signaling pathway
    107540752 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    107540752 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    107540752 (GNAI1)
   04916 Melanogenesis
    107540752 (GNAI1)
   04924 Renin secretion
    107540752 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107540752 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    107540752 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107540752 (GNAI1)
   04727 GABAergic synapse
    107540752 (GNAI1)
   04725 Cholinergic synapse
    107540752 (GNAI1)
   04728 Dopaminergic synapse
    107540752 (GNAI1)
   04726 Serotonergic synapse
    107540752 (GNAI1)
   04730 Long-term depression
    107540752 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    107540752 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    107540752 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107540752 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107540752 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107540752 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    107540752 (GNAI1)
   05032 Morphine addiction
    107540752 (GNAI1)
   05034 Alcoholism
    107540752 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107540752 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107540752 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107540752 (GNAI1)
   05163 Human cytomegalovirus infection
    107540752 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107540752 (GNAI1)
   05142 Chagas disease
    107540752 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540752 (GNAI1)
   04031 GTP-binding proteins [BR:mna04031]
    107540752 (GNAI1)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107540752 (GNAI1)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107540752 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 107540752
NCBI-ProteinID: XP_016073061
LinkDB
Position
Unknown
AA seq 302 aa
MKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAG
AAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQ
DVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDL
VLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICYPEYAG
SNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCG
LF
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaattatccacgaagctggttattcggaagaagaatgtaaacagtacaaggcagtg
gtctacagtaacaccattcagtccattattgctatcattagagccatgggaaggttgaag
atagacttcggtgactcagctcgggcggatgatgcccgtcaactctttgtgcttgctgga
gctgctgaagaaggattcatgactgcagaacttgctggcgttataaagagattgtggaaa
gatagtggtgtacaagcctgtttcaacagatcccgagagtaccagcttaatgattctgca
gcatactatttgaatgacttggacagaatagcacagccaaattacatcccaactcaacaa
gatgttctcagaacacgagtgaaaaccacaggaattgttgaaacccactttactttcaaa
gatcttcactttaagatgtttgatgtgggaggacagaggtctgagcggaagaaatggatc
cattgctttgaaggagtcactgccatcattttctgtgtggcactgagtgactatgacctg
gttctagctgaagatgaagaaatgaatcgaatgcatgaaagcatgaagttattcgacagc
atatgtaacaacaaatggtttacagaaacatctattatactttttctaaacaagaaggat
ctcttcgaagaaaaaatcaaaaagagccctctcactatatgctatccagaatatgcaggc
tcaaacacatatgaagaggcagctgcatatattcagtgtcagtttgaagatctcaataaa
aggaaggacacaaaggaaatatacacccacttcacatgtgccacagatactaagaatgtg
cagtttgtttttgatgccgtaacagatgtcatcataaaaaataatctaaaagattgtggt
ctcttctaa

KEGG   Miniopterus natalensis: 107545079
Entry
107545079         CDS       T05883                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107545079 (GNAI2)
   04371 Apelin signaling pathway
    107545079 (GNAI2)
   04071 Sphingolipid signaling pathway
    107545079 (GNAI2)
   04024 cAMP signaling pathway
    107545079 (GNAI2)
   04022 cGMP-PKG signaling pathway
    107545079 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107545079 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545079 (GNAI2)
   04670 Leukocyte transendothelial migration
    107545079 (GNAI2)
   04062 Chemokine signaling pathway
    107545079 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107545079 (GNAI2)
   04915 Estrogen signaling pathway
    107545079 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    107545079 (GNAI2)
   04921 Oxytocin signaling pathway
    107545079 (GNAI2)
   04926 Relaxin signaling pathway
    107545079 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    107545079 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    107545079 (GNAI2)
   04916 Melanogenesis
    107545079 (GNAI2)
   04924 Renin secretion
    107545079 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545079 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    107545079 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545079 (GNAI2)
   04727 GABAergic synapse
    107545079 (GNAI2)
   04725 Cholinergic synapse
    107545079 (GNAI2)
   04728 Dopaminergic synapse
    107545079 (GNAI2)
   04726 Serotonergic synapse
    107545079 (GNAI2)
   04730 Long-term depression
    107545079 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    107545079 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    107545079 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107545079 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545079 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107545079 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    107545079 (GNAI2)
   05032 Morphine addiction
    107545079 (GNAI2)
   05034 Alcoholism
    107545079 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545079 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107545079 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545079 (GNAI2)
   05163 Human cytomegalovirus infection
    107545079 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545079 (GNAI2)
   05142 Chagas disease
    107545079 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545079 (GNAI2)
   04031 GTP-binding proteins [BR:mna04031]
    107545079 (GNAI2)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107545079 (GNAI2)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107545079 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 107545079
NCBI-ProteinID: XP_016078605
LinkDB
Position
Unknown
AA seq 303 aa
MKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSC
TAEEQGVLPEDLSGIIRRLWADHGVQACFSRSREYQLNDSAAYYLNDLERIAQSDYIPTQ
QDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYT
GANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDC
GLF
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaagatcatccatgaggacggctactcagaggaggaatgccggcagtaccgggcagtc
gtctacagcaacaccatccagtctatcatggccattgtcaaagccatgggcaatctgcag
attgattttgctgacccctcccgtgcggacgacgccaggcagctgtttgcgctctcgtgc
acggctgaggagcagggcgtgctccccgaggacctgtccggcatcatccggaggctctgg
gctgaccacggcgtgcaggcctgcttcagccgctcccgggagtaccagctgaacgactcc
gctgcctactacctgaatgacctggagcgcatcgcacagagtgactacatccccacccag
caggacgtgctacggacccgtgtgaagaccacgggcatcgtggagacgcacttcaccttc
aaggacctacacttcaagatgttcgacgtgggcggccagcggtctgagcgtaagaagtgg
atccactgctttgagggtgtcactgccatcatcttctgcgttgccttgagcgcctatgac
ctggtgctagcagaggatgaggagatgaaccgaatgcacgagagcatgaagctgtttgac
agcatctgtaacaacaagtggttcacggacacgtccatcatcctcttcctcaacaagaag
gacctgtttgaggagaagatcacacacagccccctgaccatctgcttcccggagtacaca
ggggccaacaagtacgatgaggccgccagctacatccagagtaagtttgaggacctgaac
aagcgcaaggacaccaaggagatctacacacacttcacgtgtgccactgacaccaagaac
gtgcagttcgtgtttgatgccgtcactgatgtcatcatcaagaacaacctgaaggactgc
ggcctcttctga

KEGG   Miniopterus natalensis: 107545320
Entry
107545320         CDS       T05883                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04071  Sphingolipid signaling pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04360  Axon guidance
mna04371  Apelin signaling pathway
mna04540  Gap junction
mna04611  Platelet activation
mna04670  Leukocyte transendothelial migration
mna04713  Circadian entrainment
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04730  Long-term depression
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04926  Relaxin signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04971  Gastric acid secretion
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05133  Pertussis
mna05142  Chagas disease
mna05145  Toxoplasmosis
mna05163  Human cytomegalovirus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107545320 (GNAI3)
   04371 Apelin signaling pathway
    107545320 (GNAI3)
   04071 Sphingolipid signaling pathway
    107545320 (GNAI3)
   04024 cAMP signaling pathway
    107545320 (GNAI3)
   04022 cGMP-PKG signaling pathway
    107545320 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107545320 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107545320 (GNAI3)
   04670 Leukocyte transendothelial migration
    107545320 (GNAI3)
   04062 Chemokine signaling pathway
    107545320 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107545320 (GNAI3)
   04915 Estrogen signaling pathway
    107545320 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    107545320 (GNAI3)
   04921 Oxytocin signaling pathway
    107545320 (GNAI3)
   04926 Relaxin signaling pathway
    107545320 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    107545320 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    107545320 (GNAI3)
   04916 Melanogenesis
    107545320 (GNAI3)
   04924 Renin secretion
    107545320 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107545320 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    107545320 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107545320 (GNAI3)
   04727 GABAergic synapse
    107545320 (GNAI3)
   04725 Cholinergic synapse
    107545320 (GNAI3)
   04728 Dopaminergic synapse
    107545320 (GNAI3)
   04726 Serotonergic synapse
    107545320 (GNAI3)
   04730 Long-term depression
    107545320 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    107545320 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    107545320 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107545320 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545320 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107545320 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    107545320 (GNAI3)
   05032 Morphine addiction
    107545320 (GNAI3)
   05034 Alcoholism
    107545320 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107545320 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107545320 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107545320 (GNAI3)
   05163 Human cytomegalovirus infection
    107545320 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107545320 (GNAI3)
   05142 Chagas disease
    107545320 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107545320 (GNAI3)
   04031 GTP-binding proteins [BR:mna04031]
    107545320 (GNAI3)
Exosome [BR:mna04147]
 Exosomal proteins
  Proteins found in most exosomes
   107545320 (GNAI3)
GTP-binding proteins [BR:mna04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107545320 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE AAA_16
Other DBs
NCBI-GeneID: 107545320
NCBI-ProteinID: XP_016078878
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIRRLWQDGGVQACFCRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKINRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKHNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaaaatgatcgac
cgcaacctgcgtgaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggt
gctggagaatctggtaaaagcaccatcgtgaaacagatgaaaatcattcatgaggacggc
tactcagaggaagaatgtaaacagtataaagtagttgtctacagcaacaccatacagtcc
attattgccatcataagggccatgggcaggctaaagattgactttggggaagctgccaga
gcagatgatgctcggcagttatttgtcctagccggcagcgccgaggaaggagtcatgacc
ccagaactagcgggagtgatccggcggctctggcaggatggcggcgtgcaggcgtgcttc
tgcaggtccagggagtaccagctcaacgactctgcctcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgtcctgcggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagacctgtacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
atcatcttctgcgtggccctcagtgattacgacctggttttggccgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactctttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttcctcaacaagaaagacctttttgaggaaaaaataaacagg
agtcccttaactatctgttatccagaatacacgggttccaatacatatgaggaagcagct
gcttacatccagtgccagtttgaagacctgaacagaagaaaagataccaaggagatctac
acccacttcacctgtgccacagacaccaagaacgtgcagtttgttttcgacgcggtcaca
gatgtcatcattaagcacaacttaaaggagtgtggactttactga

DBGET integrated database retrieval system