KEGG   Miniopterus natalensis: 107540811
Entry
107540811         CDS       T05883                                 

Gene name
STX4
Definition
(RefSeq) syntaxin-4
  KO
K13502  syntaxin 4
Organism
mna  Miniopterus natalensis
Pathway
mna04130  SNARE interactions in vesicular transport
mna04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107540811 (STX4)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107540811 (STX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107540811 (STX4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107540811 (STX4)
Membrane trafficking [BR:mna04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    107540811 (STX4)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107540811 (STX4)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 DUF3671 DUF16 NPV_P10 Lectin_N GlutR_dimer T4SS T2SSF ERp29 Baculo_PEP_C
Other DBs
NCBI-GeneID: 107540811
NCBI-ProteinID: XP_016073137
LinkDB
Position
Unknown
AA seq 297 aa
MRDRTQELRQGDDSSDDEDKERVALVVHPGTARLGSPDDEFFQKVRTIRQTIVKLENKVR
ELEKQQVTILATPLPEESMKQDLQNLRDEIKQLGREIRGQLKAIEPQKEEADENYNSVNT
RMRKTQHGVLSQQFVELINKCNSMQSEYRERNVERIRRQLKITNAGMVSDEELEQMLDSG
QSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINR
IEKNILSSADYVERGQEHVRMTLESQKKARKKKVMIAICVSITVLILAVIICVSILA
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcgcgacaggacccaggagctgaggcagggggatgacagctcggacgatgaggacaag
gagcgggtcgcgctggtggtgcacccgggcaccgcacggctggggagcccggacgatgag
ttcttccagaaggtccggacaattcggcagactattgtcaagctggagaataaagtccga
gagctggagaaacagcaggtcaccatcctggccacgccccttcctgaggagagcatgaag
caagacctgcagaacctgcgcgacgagatcaaacagctgggaagggaaatccgcgggcag
ctaaaggccatagagccccagaaggaggaagctgatgagaattataattcggtcaacaca
agaatgagaaaaactcagcatggggtcctgtcccagcaattcgtggagctcatcaacaag
tgcaactcaatgcagtccgagtaccgggagaggaacgtggagcggattcggaggcagctg
aagatcacaaatgctggcatggtgtctgatgaggagctagaacagatgctggacagcgga
cagagcgaggtgtttgtgtccaatatactgaaggacacacaggtgactcgacaggcccta
aatgagatctcggcccggcacagtgagatccagcagcttgaacgcagtattcgtgaactt
catgagatcttcacttttctggctactgaggtggagatgcagggggagatgatcaaccgg
attgagaagaacatcctgagctcggcagactacgtggaacgtggtcaggagcatgtcagg
atgactctggagagccagaagaaggctcggaagaagaaagtgatgattgccatctgtgtg
tccatcactgtcctcattctggcagtcatcatttgcgtctccatattggcttga

DBGET integrated database retrieval system