KEGG   Miniopterus natalensis: 107540883
Entry
107540883         CDS       T05883                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
mna  Miniopterus natalensis
Pathway
mna00564  Glycerophospholipid metabolism
mna04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107540883 (ACHE)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107540883 (ACHE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
    107540883 (ACHE)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     107540883 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mna00537]
 Enzymes
  107540883 (ACHE)
SSDB
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Other DBs
NCBI-GeneID: 107540883
NCBI-ProteinID: XP_016073229
LinkDB
Position
Unknown
AA seq 614 aa
MRPPWCPLHTPFPVSPLLLLLLFLLGGGAEAEHQEDPELLVMVRGGRLRGTRLMAPGGPV
SAFLGIPFAEPPVGPRRFLPPEPKRPWPGVLDATAFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPESPTPVLIWIYGGGFYSGASSLDVYDGRFLAQAEGTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVSMGEARRRATLLARLVGCPPGGVGSNDTEL
VTCLRTRPAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINTGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPE
DPARLREAMNDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLSWPLWMGVPHGY
EIEFIFGLPLEPSLNYTIEERAFAQRLMKYWANFARTGDPNDPRDPKAPQWPPYTGVAQQ
YVSLNLRPLEVRRGLRAQACAFWNGFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaggcccccgtggtgtcccctgcacactcccttcccagtgtccccacttctcctcctc
ctcctcttcctcctgggaggaggggcagaagctgagcaccaggaggacccagagctgctg
gtgatggtgcgtgggggccggcttcggggcacccgcctaatggcccctgggggccctgtc
tctgcttttctgggcatccccttcgcagagccacccgtgggcccccgtcgctttctgcca
ccggagcccaagcgaccctggccaggggtgctagatgctacagccttccaaagtgtctgc
taccaatacgtggacaccttgtaccctggctttgagggcaccgagatgtggaacccaaac
cgtgagctgagtgaggactgcctctacctcaacgtgtggacaccataccctcggcctgag
tcccccaccccggtcctcatctggatctatgggggtggcttctacagtggggcctcttcc
ctggacgtgtatgatggccgcttcctggcccaggcagaggggactgtgctagtatccatg
aactaccgggtaggagcctttggcttcctggccctgccagggagtcgggaggctccaggc
aatgtgggtctcttggatcagaggctggccctgcagtgggtgcaggagaatgtggcagcc
tttgggggggacccaacgtcagtgactctgtttggggaaagtgcaggtgctgcctctgtg
ggtatgcacctgctgtccccacccagccggggcctgttccacagggctgtgctgcagagc
ggtgcacccaatgggccttgggctactgtgagcatgggagaggcccgccgcagggccaca
ctactagcacgtcttgtaggctgtcccccaggtggggttggtagcaatgacacagagttg
gtcacctgcttgcggacacggccagctcaggacctggtggaccacgagtggcatgtgctg
cctcaggaaagtgtcttccgcttctcttttgtgcctgtggtagacggagacttcctcagt
gacaccccagaggccctcatcaacactggagacttccatggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcctattttctggtttacggggccccaggcttcagcaaagac
aacgagtctctcatcagccgagcccagttcctggccggggtgcgggtcggggtcccccag
gcgagtgatctggctgccgaggctgtggtcctgcattacacagactggctgcaccctgag
gacccagcacgcctgagggaggccatgaatgatgtagtgggtgaccacaatgtcgtgtgt
cctgtggctcaactggctgggcgactggccgcccagggtgctcgggtctatgcctacatc
tttgaacaccgagcatccactctctcctggcccctctggatgggggtgccccatggctac
gagatcgagttcatctttgggctccccctggaaccctcgctaaactacaccatcgaggag
agagcctttgcccagcgactgatgaaatactgggccaacttcgctcgtacaggggacccc
aatgacccccgggaccccaaagccccgcagtggccaccgtacacgggggtagcacagcag
tatgtgagcctcaacctgcggcctctggaggtgcggcggggcctgcgcgcccaggcctgt
gccttttggaacggcttcctacccaaattgctcagcgccaccgacacgctggacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagtttgaccattacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system