KEGG   Miniopterus natalensis: 107540984
Entry
107540984         CDS       T05883                                 

Gene name
CNGA3
Definition
(RefSeq) cyclic nucleotide-gated cation channel alpha-3
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107540984 (CNGA3)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107540984 (CNGA3)
Ion channels [BR:mna04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   107540984 (CNGA3)
SSDB
Motif
Pfam: CLZ Ion_trans cNMP_binding Lebercilin Ion_trans_2
Other DBs
NCBI-GeneID: 107540984
NCBI-ProteinID: XP_016073365
LinkDB
Position
Unknown
AA seq 668 aa
MAKINTQYSHPNPPCPRVRTTDRDLDPMENGLRRTRSPGEETSSGLQPGIAMETRGQTES
RQGSLTGQEPARLWRLIVSLRVWASRHLRHQDQRPDSFLERFHGAELKEVSSRESSAQSN
VGSEEPADGESRKKGTIVVDPASNVYYRWLTVISLPVFYNWCLLVCRACFDELQSEHLML
WLVLDYSADVLYSLDVLVRARTGFLEQGLMVRDPKRLWRHYTKTLHFKLDVLSLVPTDLA
YFKLGINYPELRFNRLLKFARLFEFFDRTETRTSYPNVFRIGNLVLYILIIIHWNACIYF
AISKFIGFGTDSWVYPNVSNPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVV
IDFLVGVLIFATIVGNVGSMISNMNASRTEFQAKIDAIKQYMQFRKVTKDLETRVIRWFD
YLWANRKTVDEREVLKSLPDKLKAEIAINVHLDTLKKVCIFQDCEAGLLVELVLKLRPAV
FSPGDYICRKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGN
RRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKKALEEKGRQILAKDNLIDEDLANAGAD
PKDIEEKVERLESSLDTLQTRFARLLAEYSATQMKVKQRLSHLESQVQLCGSSPRPDGVA
LEPETKQQ
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccaagattaacacccagtactcccaccccaacccgccctgccctcgggtaaggacc
acagacagagatctcgatcccatggaaaatggcctccgcaggacccgctcaccaggcgag
gagacatcctcaggactgcaaccaggaatcgccatggagaccagaggacagactgaatcc
aggcaaggctccttgaccggccaggagcctgccaggctgtggcgcctcatcgtctcactg
cgcgtgtgggcttccaggcacttacgccaccaggaccagagacctgactcgttcctggag
cgtttccacggagccgagctcaaggaggtgtccagccgagaaagcagtgcccagtccaac
gtgggcagcgaagagccagcagacggagagagcaggaagaagggcaccatcgtggtggac
cccgccagcaacgtgtactatcgctggctgaccgtcatttccctgcctgtcttctacaac
tggtgcctgttggtgtgcagggcatgttttgatgagctgcagtctgagcacctgatgctg
tggctggtcctggactactctgcggatgtcctctacagcttggatgtgctggtgcgcgcc
aggaccggcttcctcgagcaaggcttgatggtcagggatcccaagaggctgtggcgacat
tacacgaagaccttgcacttcaagctggatgtgctgtcccttgtccccacggacctggct
tattttaagctgggcataaactacccagaactgaggttcaaccgcctactgaagttcgcc
cggctcttcgaattctttgaccgcacggagaccagaaccagctaccccaacgtgttccgg
atcgggaacctggtgctgtacatcctcataatcatccactggaacgcctgcatctacttc
gccatctccaagttcattggcttcggcacggattcctgggtctaccccaacgtctccaac
ccagagtacgggcgcctctccaggaagtacatttacagtctctactggtccaccttgacc
ctgaccaccatcggagagaccccgccccctgtgaaagacgaggagtacctcttcgtggtc
atagacttcctggtgggagtccttatttttgccaccatcgtgggcaatgtgggctccatg
atctcaaacatgaatgcctctcggactgagttccaggccaagattgacgccatcaagcag
tacatgcagttccgcaaggtgaccaaggacttggagacacgggtcatccgctggtttgac
tacctgtgggccaaccggaagacggtggacgagagggaagtgctcaagagcctcccggac
aagctgaaggccgagatcgccatcaacgtgcacctggacaccctgaagaaggtctgcatc
ttccaggactgtgaggcggggctcctggtggagctcgtgctgaagcttcggcccgcagtg
ttcagccctggggactacatctgcaggaagggggacatcgggagggagatgtacatcatc
aaggagggcaagctggcggtggtggctgacgatgggatcacccagtttgtggtcctcagt
gatgggagttactttggggagatcagcatcttaaacatcaaggggagcaagtcagggaac
cgcaggacggccaatatccggagcatcggttactcggacctgttctgcctttccaaggat
gacctgatggaggcgctcaccgaataccctgatgccaagaaggccctggaggagaaagga
cggcagatcctggcgaaggacaacctgatcgacgaggacctggccaacgccggggcagac
cccaaggacatcgaggagaaggtggagcgcctggagtcctccctggacaccctccagacc
aggtttgcacggctcctggccgagtacagcgccacccagatgaaagtgaagcagcgtctc
agccacctggaaagccaggtgcagctctgtgggagcagccctcggcctgacggggtcgct
ctagaaccagagaccaagcagcagtga

DBGET integrated database retrieval system