KEGG   Miniopterus natalensis: 107541076
Entry
107541076         CDS       T05883                                 

Gene name
PPP1R1A
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 1A isoform X1
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
mna  Miniopterus natalensis
Pathway
mna04261  Adrenergic signaling in cardiomyocytes
mna04720  Long-term potentiation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107541076 (PPP1R1A)
  09156 Nervous system
   04720 Long-term potentiation
    107541076 (PPP1R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107541076 (PPP1R1A)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107541076 (PPP1R1A)
SSDB
Motif
Pfam: DARPP-32
Other DBs
NCBI-GeneID: 107541076
NCBI-ProteinID: XP_016073500
LinkDB
Position
Unknown
AA seq 172 aa
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPLL
KSTLSMSPRQRKKVTRTTPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQETCPRGATD
TEAESRLSTSGKAQKPSESTPKTQERSSEKPSTEEPSARIPPLDSQGANSQV
NT seq 519 nt   +upstreamnt  +downstreamnt
atggagccggacaacagcccgcggaagatccagttcaccgtcccgctgctggagccgcac
cttgacccggaggcggccgagcagattcggaggcgtcggcccacccctgccacccttgtg
ctgaccagtgaccagtcatccccagagatagatgaagaccggatccctaacccccttctc
aagtccactttgtccatgtctccacggcaacggaagaaggtgacgaggaccacacctaca
atgaaagagctccagatgatggttgaacatcacctggggcaacagcagcagggagaggag
cctgagggagccgctgagagcacagggacccaggagacctgcccacgtggggctacagac
acagaagcggagtcaaggctgagcacctctgggaaagcacaaaagccttcagaatccacc
ccaaaaactcaggagaggagcagtgagaaacctagcacagaggaaccctcagcccgtata
ccgccactggattcccagggagccaactcgcaggtctga

DBGET integrated database retrieval system