KEGG   Miniopterus natalensis: 107541116
Entry
107541116         CDS       T05883                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04330  Notch signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107541116 (DVL3)
   04330 Notch signaling pathway
    107541116 (DVL3)
   04390 Hippo signaling pathway
    107541116 (DVL3)
   04150 mTOR signaling pathway
    107541116 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107541116 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107541116 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541116 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107541116 (DVL3)
   05226 Gastric cancer
    107541116 (DVL3)
   05217 Basal cell carcinoma
    107541116 (DVL3)
   05224 Breast cancer
    107541116 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107541116 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    107541116 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541116 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107541116 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 107541116
NCBI-ProteinID: XP_016073576
LinkDB
Position
Unknown
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSEEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPTAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggatgacaatgccaagctgccctgcttcaatggcagggtggtgtcctggctggtgtca
gctgagggctcacacccagagccagctcccttctgtgctgataacccatcggagctgccg
ccacccatggagcgcacaggaggcattggggactcccggcccccttctttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagacggactcattggtatct
gcccagcgggagcggcctcgcaggagggacggcccagagcacacaacccggctaaatgga
actgcaaaaggggagcggcggcgagagccagggggttatgacagctcgtctaccctcatg
agcagcgagttggagaccaccagcttctttgattcggaggaggatgactctaccagcagg
ttcagcagctccacagagcagagcagtgcctcacgcctaatgagaagacacaagcggcgg
cggcggaagcagaaggtttcccggatcgagcggtcctcatccttcagcagcatcacggac
tctaccatgtcactcaacatcatcacggtcactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctacattggctct
atcatgaagggtggggctgtggctgctgatggacgtatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgatgctgtccgggtactgcgg
gagattgtgcacaaaccagggcccatcaccctgactgtcgccaagtgctgggacccaagt
ccacgtggttgcttcacactgcccaggagtgaacccatccggcccattgaccctgcggcc
tgggtctcccacactgcagccatgactggcaccttccctgcctatggcatgagcccctcc
ctgagtaccatcacctccaccagctcctccatcaccagctccatccctgacacagagcgc
ctagacgacttccacctgtccattcacagtgacatggctgccattgtgaaagccatggcc
tcccctgaatctgggctggaggtccgagaccgcatgtggctcaagatcactatccccaac
gctttcattggctcagatgtcgtggactggctgtaccataacgtggaaggcttcaccgac
cggcgagaggcccgcaagtatgccagcaacctgctgaaagccggcttcatccgccacacg
gtcaacaagatcaccttctccgagcagtgctactacatcttcggtgacctctgtggcaac
atggccaacctgtccctccacgatcacgatggctccagcggtgcctctgaccaggacaca
ctggctcctttgccgcacccgggggccgccccttggcccatggccttcccttaccagtat
ccgccgcccccgcacccctacaacccgcacccaggcttcccagagctggggtacagctac
ggcgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaaccgt
agtggcagcgaccggcggaaggagaaggacccgaaggctggggactccaagtcaggcggc
agcggcagcgagtcagaccacacgacgcgcagcagcttgcgggggccgcgggagcgggcg
cccagcgagcgctcagggccggccgccagcgagcacagccaccgcagccaccactcgctg
gccagcagcctgcgcagccatcacacgcatccgagctacggcccccctggtgtgccccct
ctctacgggccccccatgctgatgatgcccccaccgcccacagccatgggacccccagga
gcccctccaggccgtgacctggcctcggtgccccctgaactgactgccagcagacagtcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Miniopterus natalensis: 107543696
Entry
107543696         CDS       T05883                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1
  KO
K02353  segment polarity protein dishevelled
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04330  Notch signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107543696 (DVL1)
   04330 Notch signaling pathway
    107543696 (DVL1)
   04390 Hippo signaling pathway
    107543696 (DVL1)
   04150 mTOR signaling pathway
    107543696 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107543696 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107543696 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543696 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107543696 (DVL1)
   05226 Gastric cancer
    107543696 (DVL1)
   05217 Basal cell carcinoma
    107543696 (DVL1)
   05224 Breast cancer
    107543696 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107543696 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    107543696 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107543696 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107543696 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C PDZ DEP DIX PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 107543696
NCBI-ProteinID: XP_016076763
LinkDB
Position
Unknown
AA seq 631 aa
MQSQQDLSVPWLRRVVKEEISADNARLPCFNGRVVSWLVLAEGAHSDAGSQATDGHTDLP
PPLERMGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEATRANGHP
RGDRRRDLGLPPDSASTVLSSELESSSFIDSEEDDNTSRLSSSTEQSTSSRLIRKHKRRR
RKQRLRQADRASSFSSITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSI
MKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTP
RSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYELEEAPLTVKSDMGAVVRVMQLPDSG
LEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKRGFLRHTVNKVT
FSEQCYYVFGDLCSNLEALNLNSGSSGASDQDTLAPLPHPAPWPLGQGYPYQYPGPPPCF
PPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSAGGSSRRALGREQERRGPGAGGSGSESD
HTAPSRAGGSTWRERPASQLSRGSSPHSQASATAPGLPPLHPLTKAYSVVGGPPGGPPVR
ELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcagtcccagcaggacctgtcggtgccctggctgaggagggtggtgaaggaggagatc
tctgctgataacgccaggctgccctgcttcaatggccgcgtggtctcctggctggtcctg
gcggagggtgctcactcggatgcaggctctcaggccaccgacggccatactgacctgccc
ccacctcttgagcggatgggcggcatcggggactcccggcccccatctttccacccgaat
gtggccagcagccgtgatgggatggacaacgagactggcaccgaatccatggtcagccac
cggcgcgagcgagcccgacgccggaaccgggaggaagccactcgggccaacggacatcca
aggggggaccggcggcgggacctgggcttgccccctgacagtgcctccaccgtgctgagc
agcgaactcgagtccagcagcttcattgactctgaggaggatgacaacacgagccggctg
agcagctctacggagcagagcacctcgtcccggcttatccggaagcacaagcggcggcgg
cggaagcagcgccttcggcaggcagaccgcgcctcttccttcagcagcatcacagactcc
accatgtccctgaatatcatcacggtcacgctcaacatggagaggcaccacttcctaggc
atcagcatcgtgggtcagagcaacgaccggggcgatggtggcatctacatcggctccatc
atgaagggcggggctgtggctgcggacggccgcatcgagcccggagacatgctgctgcag
gtgaacgatgtcaactttgagaacatgagcaatgacgacgctgtgcgggtgctgcgggag
attgtgtcccagacagggcccatcagcctcacggtggccaagtgctgggacccaaccccc
cggagctacttcacggtcccgagggctgaccccgtccggcccatcgacccagccgcttgg
ctgtcgcacacggcggcgctgaccggagccctgccccgctacgagctggaggaggcgcct
ctgacggtaaaaagtgacatgggagccgtggtccgggtcatgcagctgccggactctggc
ctggagatccgcgaccgcatgtggctcaagatcaccattgccaacgccgtcatcggtgct
gacgtggtggactggctgtatacgcacgtggagggcttcaaggagcggcgggaggcccgc
aaatacgccagcagcatgctgaagcgcggcttcctgcggcacaccgtgaacaaggtcacc
ttctccgagcagtgctactacgtctttggggacctgtgcagcaatcttgaagccctgaat
ctcaacagcggctccagcggggcctcggatcaggacacgctggccccgctgccccacccg
gctccctggcccctgggtcagggatacccctaccagtacccagggcccccgccctgcttc
ccgcccgcataccaggaccctggcttcagctacggcagtggcagtgctgggagtcagcag
agtgaaggaagcaaaagcagcgggtctacccggagcgcgggcgggagcagccggcgggcc
ctgggccgagagcaggagcgccgggggcctggagctgggggcagtggcagcgagtcagac
cacacggccccaagcagagcaggtggcagcacttggagggagcgtcccgccagccagctc
agtcgtggcagcagcccacacagccaggcctcggccactgctccggggctccccccactg
caccccctgacgaaggcgtactcagtggtgggtgggccgcctggggggccccctgtccgg
gagctggccgctgtccccccagagctgacaggcagtcgccagtccttccagaaggccatg
ggaaacccctgtgagttctttgtcgacatcatgtga

KEGG   Miniopterus natalensis: 107544485
Entry
107544485         CDS       T05883                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
mna  Miniopterus natalensis
Pathway
mna04150  mTOR signaling pathway
mna04310  Wnt signaling pathway
mna04330  Notch signaling pathway
mna04390  Hippo signaling pathway
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04916  Melanogenesis
mna04934  Cushing syndrome
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05165  Human papillomavirus infection
mna05200  Pathways in cancer
mna05217  Basal cell carcinoma
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107544485 (DVL2)
   04330 Notch signaling pathway
    107544485 (DVL2)
   04390 Hippo signaling pathway
    107544485 (DVL2)
   04150 mTOR signaling pathway
    107544485 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107544485 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107544485 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544485 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107544485 (DVL2)
   05226 Gastric cancer
    107544485 (DVL2)
   05217 Basal cell carcinoma
    107544485 (DVL2)
   05224 Breast cancer
    107544485 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107544485 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    107544485 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107544485 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107544485 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 107544485
NCBI-ProteinID: XP_016077877
LinkDB
Position
Unknown
AA seq 729 aa
GGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVV
KEEISDDNARLPCFNGRVVSWLVSSDNPQLEIAPPAQEPRTELAPPTPPLPALPPERTSG
IGDSRPPSFHPNVSSSRENLEPETETESVASLRRERPRRRDSSEHGAGGHRPSGPSRLER
HLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRL
ERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAA
DGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPR
NEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIHTDMASVT
KAMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGL
IRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPL
LPTFPYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRP
EERAPESKSGSGSESEPSSRGGSLRRGGEPGGTGDGGPPPSRSSSGGAPNLRTHPGLHPY
GPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGN
PSEFFVDVM
NT seq 2190 nt   +upstreamnt  +downstreamnt
ggtggtggtgtcggggagacgaaggtgatttaccacctggatgaagaggagactccctac
ctggtgaagattccggtccccgctgagcgcatcaccctcggagatttcaagagcgtcctg
cagcggcccgcgggcgctaagtactttttcaagtctatggatcaggatttcggggtggtg
aaggaagaaatttcagatgacaatgcccgccttccctgcttcaatggaagggtagtctcc
tggcttgtgtcatcagataaccctcaactcgagatagctcccccagcccaggagcctcgg
acagaactggcgccaccaacgccaccattacccgctttgccaccagagaggaccagtggc
attggggactccagacctccatccttccaccctaatgtgtccagcagccgggaaaatctg
gaacctgagacagaaacagagtcagtagcatctctaaggcgggagcggcctcgcaggaga
gacagcagtgagcatggcgctgggggccacaggcccagtggcccctcgaggctggagcgc
cacttggccgggtacgagagttcttcaaccctcatgaccagcgagctggaaagcaccagc
ctgggggactctgacgaagacgacaccatgagtaggttcagcagctccacggagcagagc
agtgcctctcgcctcctcaagcgccaccggcggcggaggaaacagcggccacctcgcctg
gagaggacctcatccttcagcagcgttactgattccaccatgtctctcaacatcatcaca
gtcacactcaatatggagaagtacaacttcctgggcatctccattgtgggccaaagcaat
gagcggggagacgggggcatctacatcggctccatcatgaagggtggggccgtggcagct
gatgggcgcatcgagccaggggacatgcttttgcaggtgaatgacatgaactttgagaac
atgagcaacgacgacgcggtgagggtgctgagagacattgtgcataagccaggccccatc
gtgctgactgtggccaagtgctgggatccctctccccaggcctatttcactctcccccga
aatgagcccatccaaccaattgaccccgctgcctgggtctcccactccgcagcactaact
ggcaccttcccagcctatccaggctcctcgtccatgagcaccattacatctgggtcctct
ttgcctgatggctgtgagggccgaggtctctccatccatacagacatggcatctgtgacc
aaggccatggcatctccagagtctggactggaagttcgggaccgcatgtggctcaagatc
accatccctaatgcctttctgggttcggatgtggtcgattggctctaccatcatgtggag
ggctttcctgagcggcgggaggcccgaaagtatgccagcgggctgctcaaggcgggcctt
atccggcacaccgtaaacaagatcactttctctgagcagtgctattatgtctttggagac
ctcagtggcggctgtgagagttatctagtcaatctgtctctgaacgataatgacggctcc
agtggggcttcggaccaggacaccttggctcctctccctggggccaccccctggcccctg
ctgcccaccttcccctaccagtacccagccccacacccatacagccctcagcctccaccc
taccatgagctctcttcctacacctatggtggaggcagtgccagcagccagcacagtgaa
gggagccggagcagtgggtccacacgaagcgatgggggggcagggcgcacagggaggcct
gaggagcgggcccctgagtccaagtctggcagcggcagtgagtccgagccctccagccgg
gggggcagccttcggcggggtggggaacctggtgggactggtgatgggggccctccccct
tccaggagctcatcagggggtgctcccaatctcagaacccacccagggcttcatccctat
ggaccaccccctggtatggccctcccctataaccccatgatggtggtcatgatgcctccc
cccccccctcctgtccctccagcagtacagcccccaggggcccctccagtcagagaccta
ggttcagtgcccccagagctgacagccagccgccaaagcttccacatggccatgggcaac
cccagtgagttctttgtggatgttatgtag

DBGET integrated database retrieval system