KEGG   Miniopterus natalensis: 107541208
Entry
107541208         CDS       T05883                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03440  Homologous recombination
mna04064  NF-kappa B signaling pathway
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04210  Apoptosis
mna04218  Cellular senescence
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05202  Transcriptional misregulation in cancer
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107541208 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107541208 (ATM)
   04068 FoxO signaling pathway
    107541208 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107541208 (ATM)
   04210 Apoptosis
    107541208 (ATM)
   04115 p53 signaling pathway
    107541208 (ATM)
   04218 Cellular senescence
    107541208 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107541208 (ATM)
   05206 MicroRNAs in cancer
    107541208 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107541208 (ATM)
   05170 Human immunodeficiency virus 1 infection
    107541208 (ATM)
   05165 Human papillomavirus infection
    107541208 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107541208 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107541208 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mna03032]
    107541208 (ATM)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107541208 (ATM)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107541208 (ATM)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   107541208 (ATM)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107541208 (ATM)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107541208 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC DUF2972
Other DBs
NCBI-GeneID: 107541208
NCBI-ProteinID: XP_016073689
LinkDB
Position
Unknown
AA seq 3060 aa
MSLALNDLLICCRQLEHDRPTERRKVVEKFKRLIRDPETIQHLDRHTDSKQGKYLNWDAV
FRFLQKYIQKETECLKIAKPNVSASTQAVRQKKMQEISSLVKYFIKCANKRAPRLKCQEL
LNYIMDTVKDSSNGATFGADCSNILLKDILSVRKYWCEISQPQWLELFSVYFRLYLNPSQ
DINRVLVARIIQAVTKGCCSQTDGLNSKFLDFFSKAIQNARQEQTSPGLNHVLAAFVIVL
KTLAVNFRTQVCDLGDKILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESRKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIELMADVCHQVFNED
TRSLEISQPYTTTQREISDYSVSCKKRKIELGWDVIKDHLQKSQNDFELVPWLQITTQLI
SKYPASLPNSELSPLLMILYQLLPQQRRGERTPYVLRCLMEVALCQGKKSNLESSQKSDL
LKLWIKIWSITFRNISSEQIQVENFGLLGAIIQGNLVEVDREFWKIFTGSACRPSCPVIR
CLTLALTNCVVPETVKTGMEQNICEVNKSFSLKELIMKWLLLYQLEDDFEDSTELPPILH
SNFPHLALEKILVSLTMKNCKAAMNFFQSVPECAQYPKEKEEPSFSAVEELFLQTTFDKM
DFLTIVEKCTIEKHQSSRGFSVHQNLKESLDRYLLGLSEQLLNNYSSETTNTETLVRCSS
LLVGVLGCYCYVGVITEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEESRIVSLRNMM
HLCTSCLCNCNKHNPNKIASSLFLRLLTSKLMNDIADVCRSLVSFTKKPLDYGQLEPMED
DTDENVKEMESQSSMSLFNDYPPSSISDANESGESQLTIGSMNPLAEEHLSKQDLLLLDM
LKFLCVCVTTAQTSTVSFRAADIRRKLLMLIDSSILDPTKSLHLHMYLVLLKELPGEEYP
LPMEDVVVLLKPLSKLCSLYRRDQDVCKTILNHIIYTVGNLCQGNMDSENTGDAQGEFLT
VVGAFWHLTKEGKCTFSVRMALVKCLKALLEADPYSKWAILNAMGKAFPVNEVFPQFLAD
NDHQIRMLAAESINRLFQDMKQAGSSTLLKALPLKLQQTAFENAYLKAQEGMREVPHRAE
NPELLDEIYNRKAVLLMMIAVVLCCSPVCEKQALFALCKSVKENGLEPHLIKKVLEKVSE
TFGYRHLEDFMASHLDYLVFEWLNLQGAEYSLSSFPFILLNYTNIEDFYRSCYKVLIPHL
VIRSDFDEVKSIANHIQEDWKRLLIDCFPKILVNILPYFAYESIGDSGMAQQRETATKVY
DKLKDENLLGKQIDHLFVTNLPEIVVELLMTLHEPVTAGASQSTDLYDFSGYGDLDPAPN
PPHFPSHVIKATFAYISNCHKTKFKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHR
ILKIYHLFVSLLLKDIKTGLGGAWAFVLRDVIYTLIHYINKRPSRFMDVSLRSFSLCCDL
LCRVCRTAVTYCKDALENHLHVIVGTLIPLVDDQMEVQEQVLDLLKYLVIDNKDNENLYI
TIKLLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSAYDALPLTRLEGLKDL
RRQLEQHKDQMMELMRASQDNPQDGVMVKLVVNLLQLSKMALNHTGEREVLEAVGGCLGE
VGPVDFSTIAIQHSKDISNTKALELFEDKELQWTFIVLTYLNNTLVEDCVKVRSATVTCL
KNILATKTGHSFWEIYKTTSDPMLIYLHPFRTSRKKFLEVPKLDIENPLEGLDDTNLWIP
QSEDHDIWIKTLTCAFLDSGSIKSEILQLLKPVCEVKADFCQTVLPYLIHDILLQDTNES
WRNLLSTHIQGFFTHCFRHSSQTNRSTTPTSLDSEPEHFSRCCLGKKSQRTMLAVVDYMR
RQKRSSSGTVFDDAFWLKLNYLEVAKVAQSCAAHFTALLYAEIYADKKNAEDQEQRNLAF
EEGSQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRLRTYE
HEAMWEKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLGDENKEWSAELQE
LHYQAAWRNMQWDHCTSVNKGIEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEE
LCKGSLESVCSLYPALSRLQAIGELEDIGELFSRSVMDRQPSEVYIKWRKHSQLLKDSDF
SFQEPIMALRTVILELLMEKEMENSQKECIKDILTKHLVELSILARTFKNTQLPERAIFQ
IKQYNSAGCGVSGWQLEEAQVFWAKQEQSLALSILKQIIKTLDASCLENDPSLKLIHTEC
LRVCGNWLAETCLENPAVIMQTYLEKAVEVAGSYDGESNDELRNGQMKAFLSLARFSDTQ
YQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQSNDRYTIKVQRELELDECALRALK
EDRKRFLCKAVENYISCLLSGEGHDTWIFRLCSLWLENSGVSEVNGMMKRDGMKIPSYKF
LPLMYQLAARMGTKMMGGLGFHEVLNNLISRISTDHPHHTLFIILALANANKDESLTKPE
AAERSRITKRTPKQSSQLDEDRIKAANKIICTIRSRRPQMVRSVETLCDAYIILANFDAT
QWRTQRKGIKIPADQPITKLKNLEDVVVPTMEIKVDPTGEYGNLVTIKSFKTEFHLAGGV
NLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTKTRKRKLTICTYK
VVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPNDISAYQCQKKMLDVQKKSYEEK
YETFMLICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNI
LINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTME
VMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRLEDEAELHSTLNADDQECKHSLS
EIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAWV
NT seq 9183 nt   +upstreamnt  +downstreamnt
atgagtctagctcttaatgatctgcttatttgctgccgtcaactggaacatgatagacct
acggaacgaaggaaagtagttgagaaatttaagcgtctgattcgggaccctgaaaccatt
caacatttagatcggcatacagattccaaacaagggaaatatttgaattgggatgctgtt
tttagatttttacagaaatatattcagaaagaaacagaatgtctgaaaatagcaaaacca
aatgtgtctgcttcaacacaagccgtcaggcagaaaaaaatgcaagaaatcagtagcttg
gtcaaatacttcatcaaatgtgcaaataaaagagcacccaggctgaaatgtcaagaacta
ttgaattatatcatggacacagtgaaagattcatctaatggtgccacttttggagctgat
tgtagcaatatactgctcaaggacattctctcagtgaggaaatactggtgtgaaatatct
cagccacagtggctagaattgttttctgtgtacttcaggctgtatcttaacccttcacaa
gacattaacagagttttagtggctagaatcattcaagctgtgactaaaggatgctgttca
caaactgatggattgaattccaaatttttggattttttctccaaggctattcagaatgca
agacaggaacagacttctccaggtctaaatcacgtcttagcagcatttgttatcgtcctc
aagactttggctgttaactttcgaactcaagtatgtgatctaggagataaaatccttcct
accttgctttatatttggactcaacacagacttaatgattccttaaaagaagtaattatt
gaattatttcaactgcaaatttatatccatcatccaaagggagccaaaacccaagaaaaa
ggtgcttatgaatcaagaaaatggaaaagtatcttatacaacttatatgatctgctagtt
aatgagataagtcatataggcagcagagggaaatattcctcaggatctcgtaatattgct
gtcaaggaaaacttgattgaattgatggcagatgtttgtcaccaggtttttaatgaagat
accagatctttagagatttctcagccttacactaccacacaaagagaaattagtgattac
agtgtatcttgcaaaaagaggaaaatagaattaggctgggacgtaataaaagatcatctc
cagaagtcacagaatgattttgaacttgtgccttggttacagattacaacccaattaata
tcaaaatatcctgcaagtttacctaacagtgagctgtcaccattattgatgatactatac
cagcttctacctcaacagcgacgtggggaacgtacaccatatgtgttacgatgccttatg
gaagttgcattgtgtcaaggcaagaaatcaaacctagaaagttcacaaaaatcagattta
ttgaaactctggattaaaatttggtctattacctttcgcaatataagttctgaacaaata
caagttgaaaattttggcttacttggagccataattcaagggaatttagttgaggttgac
agagaattctggaagatatttaccggttcagcctgcagaccttcatgtcctgtcatacgc
tgtttgactttggcactgaccaactgtgtagttccagaaacagtaaaaacaggaatggag
cagaatatatgtgaagtaaataaaagtttttctttaaaggaattgataatgaaatggctc
ttactctatcagttagaagatgactttgaagacagtacagagctacctccaattcttcac
agtaattttcctcatcttgcactggagaaaattcttgtgagtctcactatgaaaaactgt
aaagctgcaatgaattttttccagagtgtgccggaatgtgcacaatacccaaaagagaaa
gaagagccttcattctcagcagttgaagagctatttcttcagacaacttttgacaagatg
gattttttaaccattgtggaaaaatgtactatagaaaagcaccaatccagtagaggattt
tctgtccaccaaaatctcaaggaatcactggatcgctatcttctgggattgtcagaacag
cttctaaataactactcctctgagactacaaatacagaaacgcttgtccggtgttcaagt
cttttggtgggtgttcttggttgctattgttatgtgggtgtaataactgaagaggaagca
tataaatcagaattattccagaaagccaagtctctaatgcagtgtgctggagaaagtatt
actctgtttaaaaataagacaaatgaggaatctagaattgtttcattgagaaatatgatg
catctatgtacaagttgtttatgtaactgtaacaagcacaatccaaataagattgcatct
agccttttcctacgcttgttaacatcaaagctaatgaatgatattgcagatgtttgtaga
agtttagtatcctttaccaaaaagccacttgattatggacaattagaaccaatggaagat
gatactgatgaaaatgtaaaggagatggagagtcagtcatccatgagtctatttaatgat
taccctcctagtagtattagtgatgcaaatgaatctggagagagccagcttactattggt
tccatgaatcctttagctgaagaacacctgtcaaaacaagatctacttcttttagacatg
ctcaagtttttgtgtgtgtgtgtaaccactgctcagaccagtactgtgtcatttagagca
gctgatattcggaggaaattgttaatgttaattgattctagcatactagaccctactaaa
tctctccatctacacatgtatctagtgcttttaaaggagcttcctggagaagagtatcct
ttgccaatggaagatgttgttgtacttctgaaaccactatccaaattgtgttctttgtat
cgccgtgaccaagatgtttgtaaaacaattttaaaccacatcatttatacagtggggaac
ctatgtcaaggcaatatggattctgagaacacaggggatgctcaaggagagtttctaaca
gttgttggagcattttggcacttaacaaaggaggggaaatgcacgttctctgtaagaatg
gcactagtaaaatgcctgaaagctttgcttgaggctgacccttattcaaaatgggctatt
cttaacgccatgggaaaagcctttcctgtaaatgaagtatttccacaatttcttgctgat
aatgatcaccaaattcgaatgttggctgcagagtcaatcaatagattatttcaggatatg
aaacaagcaggttcttccacgttattgaaagcacttcctttgaagctccagcagacagct
tttgaaaatgcatacctgaaagctcaggaaggaatgagagaagtgccccacagagctgag
aaccctgaacttttggatgagatttataatagaaaagctgttttactgatgatgatagct
gtggttttatgctgtagtcctgtttgtgaaaaacaggctttgtttgccctatgtaagtcc
gtgaaagagaatggattagaacctcacctcattaaaaaggttttagagaaagtttctgaa
acttttggatatagacatttagaagacttcatggcttctcatttggattatctggttttt
gaatggctaaatcttcaaggtgctgaatacagcttatcctcttttccttttattttatta
aactacacaaacattgaggatttctatagatcttgttataaagttttgattccacatctg
gtgattagaagtgattttgatgaggtgaaatccattgctaatcacattcaagaggattgg
aaacgtcttctaatagactgctttccaaagattcttgtcaatattcttccgtactttgcc
tatgagagtataggagacagtgggatggcacagcaacgagagactgctaccaaagtctat
gataagcttaaagatgaaaacttactaggaaaacagattgatcacttattcgttactaat
ttgccagagattgtggtggagttattgatgacattacatgaacctgtgactgctggtgcc
agccaaagcactgacctctatgacttttcaggatatggggatttggatcctgctcctaat
ccacctcattttccgtcgcatgtgattaaggcaacatttgcctatatcagcaattgccat
aaaaccaagtttaaaagcattttagaaattctttccaaaagccctgattcctatcagaaa
attcttctagccatatgtgagcaagccgctgagacaaacaacgtttataaaaagcacaga
attcttaaaatatatcacctgtttgttagtttattactgaaagatataaaaactggctta
ggaggagcttgggcctttgttcttcgagatgttatttataccttgattcactatatcaac
aaaagaccttcccgttttatggatgtgtcattgcgcagcttctccctttgttgtgaccta
ttatgccgggtttgccgcacagcagtaacttactgtaaggatgctttagaaaatcatctt
catgttattgttggtacacttataccccttgtggatgatcagatggaggttcaggaacag
gtattggacttgttgaaatacttagtgatagataacaaggacaatgaaaacctctacatc
acaattaaacttctagacccttttcctgaccatgttgtctttaaggatctgcgtattact
cagcagaaaatcaaatacagtagaggacctttttcactcttggaggaaattaaccatttt
ctctcagtaagtgcttatgatgcacttccattgacaaggcttgaaggattgaaggatctt
cgaagacaacttgaacaacataaagatcagatgatggagcttatgagagcatctcaggat
aacccacaagatggcgtaatggtgaagctagttgtcaacttgttgcagttatccaagatg
gccttaaaccacactggtgaaagagaagttttagaggctgttggaggctgtttgggagaa
gtgggtcctgtagatttctctacaatagctatacaacatagtaaagatatatctaatacc
aaagcccttgagttatttgaagataaagaacttcagtggacctttatagtgctgacctac
ctgaataacacactggtagaagattgtgtcaaagtgcgatcagctactgttacctgtttg
aaaaacattttagccacaaagactggtcacagtttctgggagatttacaagacgacctct
gatcccatgctgatctacctacacccttttagaacatcgaggaaaaagtttttagaagta
cccaaacttgacatagaaaaccctttagagggcttggatgatacaaacctgtggattcct
caaagtgaagatcatgacatttggataaagacactgacttgtgcatttttggatagtgga
agcataaaaagtgaaattctccaattactaaagccagtgtgtgaggtgaaagctgacttt
tgtcagactgtgcttccgtacttgattcatgatattttactccaagatacaaatgaatca
tggaggaatctgctttctacacatattcagggatttttcactcactgttttagacactcc
tcacaaacaaaccgctccacgacccctacaagtttggattcagagccagagcacttttcc
cgatgttgcttgggtaaaaaatcacaaagaacaatgcttgctgttgtggactacatgagg
agacaaaagagatcttcttcaggaacagtgtttgatgatgctttctggctgaagttgaat
tatctagaggttgccaaggtagctcagtcttgtgctgctcactttacagcattactctat
gcagaaatctatgcagataagaaaaacgcggaagatcaagagcaaagaaatcttgcattt
gaagagggaagccagagcacaaccatttctagtttgagtgaaaaaagtaaagaagaaact
ggaataagtttacaggatctgctcttagaaatctacagaagcataggagagccagatagt
ctgtatggctgtggcggagggaagatgctgcaaccccttacgagactacgaacatatgaa
catgaagcaatgtgggagaaagccctagtaacttacgaccttgagacagccatctcttca
tcaacccgccaggcaggaatcattcaggccttgcagaatttgggactgtgtcatattctt
tctgtctacttaaaaggattaggtgacgaaaataaagagtggtctgctgaactgcaggaa
cttcattaccaagcagcatggaggaatatgcagtgggaccactgcacttctgttaacaaa
ggaatagaaggaaccagttaccatgaatcgttgtacaatgctttgcagtctttaagagac
agagaattctccacattttatgaaagtctcaaatatgccagagtaaaagaagtagaagag
ttgtgtaagggcagccttgagtctgtgtgttcactctaccctgcacttagcaggttgcag
gccattggagagctcgaagacattggggagcttttctcaagatcagtcatggataggcaa
ccctctgaagtatacattaagtggcggaaacactcccagcttctcaaagacagtgatttt
agctttcaggagcctatcatggctctacgcacagtcattttggagctcttgatggaaaag
gaaatggagaactcccaaaaagaatgtattaaggacatactcaccaagcatcttgtagaa
ctctccatactagcccgaactttcaagaacacccagctccctgaaagggcaatatttcaa
attaaacagtataattcagctggttgcggagtgtcggggtggcagctggaggaggcgcaa
gtgttctgggcgaagcaggagcagagccttgccctgagcattctcaagcaaattatcaaa
acgttggatgccagttgcttggagaatgatcccagcctaaaacttatacacacagaatgt
ctgagggtttgtggcaactggttagcagaaacttgcctagaaaatcctgcggtcatcatg
cagacctacctagaaaaggcagtggaagttgctggaagttatgatggagaaagtaatgat
gagctcagaaatggacaaatgaaggcatttctctcattagcacggttctcagatactcag
taccagaggattgaaaactacatgaaatcatcagaatttgaaaataaacaagctctcctg
aagagggccaaagaggaagtgggccttcttagggaacataaaattcagtccaatgacaga
tacacaataaaggttcagcgagagctggagctggatgaatgtgcactccgtgcgctgaaa
gaagatcggaaacgcttcttatgtaaagctgttgaaaattacatcagttgcctattaagt
ggagaagggcatgatacatggatatttcgtctttgttccctctggcttgaaaattctgga
gtttctgaagtcaatggcatgatgaagagagatggaatgaagattccatcatataaattt
ttgcctcttatgtaccaattggctgctagaatggggaccaagatgatgggaggcctagga
tttcatgaagtcctcaataacctcatctctagaatttcaacggatcacccccatcataca
ttgtttattatattggccttagcaaatgcaaacaaagatgaatctttgaccaagccggag
gcagcagaaaggagtagaataactaaaaggacacctaaacagagctctcagcttgatgag
gatcgaatcaaggctgcaaacaaaataatatgtactatcagaagtaggagacctcagatg
gtcagaagtgttgagacactttgtgatgcttatattatattagcaaattttgatgccact
cagtggaggactcagagaaagggcataaagattccagcagatcagccaattactaaactt
aagaatttagaagacgtggttgttcctactatggaaattaaggtggaccccacaggagaa
tatggaaatctggtgactataaagtcattcaaaacagaatttcatttagcaggaggtgta
aatttaccaaaaataatagattgcgtgggctctgatggcaaggaaaggagacagcttgtc
aagggccgtgacgacctgagacaagatgctgtgatgcagcaggttttccagatgtgcaat
acgctgctgcagaggaacaccaagaccaggaagaggaaattgactatctgcacatacaag
gtggttcccctttctcagcgaagtggtgttcttgaatggtgcacgggaactgtccctatt
ggtgaatttcttgttaacaatgagaatggtgctcataaaagatacaggccaaacgatatc
agtgcctatcagtgccagaagaaaatgttggatgtgcaaaagaagtcttacgaagagaaa
tatgaaaccttcatgcttatttgtcagaattttcaaccagtttttcgttacttctgcatg
gaaaaattcttggacccagctgtttggtttgagaaacgattggcctatactcgcagtgtg
gctacttcttctattgttggttacatacttggacttggtgatagacatgtacagaatatc
ttgataaatgagcagtcagcagaacttgtacatatagatttaggagttgcttttgaacag
ggtaaaatccttcctactcctgaaacagtcccttttagactcaccagagatattgtggat
ggaatggggattactggtgttgaaggcgtcttcagaagatgctgtgagaaaaccatggag
gttatgagaaattctcaggagacgctgttaaccattgtagaggtcctcctgtacgatcct
ctctttgactggaccatgaaccctttgaaagctttgtatttacagcagaggctggaagat
gaagctgagctccactccaccctgaatgcagatgaccaagaatgcaaacacagtctcagt
gaaattgaccagagtttcaacaaagtagccgaacgtgtcttgatgagactacaagagaaa
ctaaaaggagtggaggaaggaactgtgctcagtgtgggtgggcaagtgaatttgctcatt
caacaggccatggaccccaaaaacctcagccgacttttcccaggatggaaagcgtgggtg
tga

DBGET integrated database retrieval system