KEGG   Miniopterus natalensis: 107541326
Entry
107541326         CDS       T05883                                 

Gene name
TNNI3
Definition
(RefSeq) troponin I, cardiac muscle
  KO
K12044  troponin I, cardiac muscle
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04260  Cardiac muscle contraction
mna04261  Adrenergic signaling in cardiomyocytes
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107541326 (TNNI3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107541326 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    107541326 (TNNI3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107541326 (TNNI3)
   05414 Dilated cardiomyopathy
    107541326 (TNNI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107541326 (TNNI3)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107541326 (TNNI3)
SSDB
Motif
Pfam: Troponin Troponin-I_N Tup_N DUF919 DUF3738 CorA
Other DBs
NCBI-GeneID: 107541326
NCBI-ProteinID: XP_016073837
LinkDB
Position
Unknown
AA seq 209 aa
MADESNDAAGEPRPAPARRRSSANYRAYATEPHAKKKSKISASRKLQLKMLMLQIAKQEL
EQEAEERRGEKARALSTRCQPLELAGLSFEELQDLCRQLHARVDKVDEERYDVEAKVTKN
ITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDT
EKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcggacgagagcaacgacgcggcgggggaaccgcgccccgcccccgctcgacgccgc
tcctccgccaactaccgcgcctacgccaccgagccgcacgccaagaaaaagtctaagatc
tccgcctccagaaaactgcagctgaagatgctgatgctgcagatcgcgaagcaggagctg
gagcaggaggcagaggagcggcgtggagagaaggctcgtgctctgagcacgcggtgccag
cccctggagttggccgggctgagcttcgaggagctgcaggacttgtgccgacagctccac
gcccgcgtggacaaagtggatgaggagagatatgatgtggaggccaaagtcaccaagaac
atcacggagatcgcagatctgacccagaagatctttgacctccggggcaagttcaagcgg
cccaccctgcggagggtgcggatctctgcggatgctatgatgcaggcgctgctgggcacc
cgggcgaaggagtccttagacctgcgggcccacctcaagcaggtgaagaaggaggacacg
gagaaggaaaaccgggaggtgggagactggcgcaagaacatcgatgcgctgagtggcatg
gagggccgcaagaaaaagtttgagggttga

DBGET integrated database retrieval system