KEGG   Miniopterus natalensis: 107541336Help
Entry
107541336         CDS       T05883                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H2
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mna  Miniopterus natalensis
Pathway
mna00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107541336 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mna03036]
    107541336 (KMT5C)
Enzymes [BR:mna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107541336 (KMT5C)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107541336 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107541336
NCBI-ProteinID: XP_016073854
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMTHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMERNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLRPQKPLPPQPLDKYQLRETKRRLLQSLGSRLSPWACAHQSPLRQDPFCATCQPLRL
LPCGTRPDASPLWVQWLPQPQLWTRPRRRRRPQPRRAPMPPILRAARVSLHRWGGCGPHC
CLQAEALVALGSVPRTRWTPQQDWHWARRYGLPYVLRVDLSRAVPAPPATPTPSPTPTGT
PGSVPIPKQALAFVPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggggccagacagagtgacagcccgagagctgtgcgagaacgacgacctggccaccagc
ctggtcctggacccctacctgggcttccgcacccataagatgaatgtcagccctgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggctttcctgaggcagcgggac
ctggaagctgcataccgggccctgacgctgggaggctggatgacccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgtgccttc
ctgcctgaaagcggctttaccatcctgccctgtacccgctattccatggagaggaatgga
gccaagattgtgtctacccgagcttggaagaagaacgaaaagctggagctgctggtgggc
tgcatcgcggagctgcgggaggccgacgaggggctgctgcgggcgggcgagaacgacttc
agcatcatgtactccacgcgcaagcgcagcgcccagctgtggctcggccccgccgccttc
atcaaccacgactgcaaacccaactgcaagtttgtgcccgcagatgggaacgcagcctgc
gtgaaggtgcttcgggatattgagccaggggatgaggttacctgcttctacggggaaggt
ttttttggtgaaaagaacgagcactgtgaatgctacacctgcgagaggaaaggggaagga
gctttccgcctgaggccccagaagcccttgccgccgcagcccctggacaagtaccagctc
cgggaaaccaagcggaggctgctgcagagcctgggcagtcggctgagcccctgggcctgt
gcccaccagtctcctctgcgccaggacccgttctgcgccacctgccagcccctgcgcctc
ctgccctgtggcacccgccctgatgcctctcccctctgggtccagtggctaccgcagccc
cagctatggacacgaccccggaggcgccgtcgcccccagccccggcgggcccccatgccc
cccattctccgtgctgcccgtgtctccctgcaccggtggggaggctgtggcccccactgc
tgcctgcaggcggaggccctggtcgccctgggctctgtcccccgcacccgctggaccccc
cagcaggactggcactgggcccggcgttatgggctgccttacgtgttgcgtgtggacctg
agccgggcggtcccagcccctcctgccactcccacccccagccccacacccactgggaca
ccaggctctgttcctatccccaagcaggccctcgcctttgtacccttctccccacccaag
cgcctgcggctggtggtcagccacggctccattgacctagatgtgaatggtgacgggccg
tga

DBGET integrated database retrieval system