KEGG   Miniopterus natalensis: 107541458
Entry
107541458         CDS       T05883                                 

Gene name
BMP15
Definition
(RefSeq) bone morphogenetic protein 15
  KO
K05498  bone morphogenetic protein 15
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107541458 (BMP15)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107541458 (BMP15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107541458 (BMP15)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107541458 (BMP15)
SSDB
Motif
Pfam: TGF_beta
Other DBs
NCBI-GeneID: 107541458
NCBI-ProteinID: XP_016074008
LinkDB
Position
Unknown
AA seq 395 aa
MVLLSIFRIILLWGLVLFTEHRVQMEKVGQPSTALLAEAPTFPLIRELLEEAPGKQQRKP
QVLGYPMKYMLELYQRSADTRGHPRENRTIGATMVRLVRPSANVARPLRGPQHIQTLDFP
LRPNQVAYQLIRATVLYRHQLHLAGFHLSCHVEPWLQKSQTNHFPSSGRGSSKPSLLFNT
WTEMDITQHIQQRLWNHKRHRVLRLHFMCQQQKGSEGLELLWHGTSSLDTAFLLLYFNDT
HKSVLKAKLLTGSLEEFMERDSSLLLRRARRAGSIASKIPGPSQERDGPETNQCSLHHFQ
VSFHQLGWDHWIIAPSLYTPNYCKGACPRVLRYGLNSPNHAIIQNLVNELVNQSVPQPSC
VPYKYVPISILMVEANGSILYKEYEDMIAQSCTCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtcctcctcagcatctttagaattattcttctttggggactggtgctttttacagaa
cacagagtccaaatggaaaaggtagggcaaccctctactgccctcctggctgaggccccc
acctttcccctgattcgggagctgctagaagaagcccctggcaagcagcagaggaagcca
caagtcctagggtatcccatgaaatacatgctggagttgtaccagcgttcagctgacacg
cgtgggcaccctagggagaaccgcacaattggggccacaatggtgaggctggtgaggcct
tcagctaatgtagcaaggcctctcagaggcccccagcatatacagaccctggactttcct
ctgaggccaaaccaggtagcttaccaactaatcagagccactgtgctttaccgccatcaa
ctccacctagctggcttccacctctcctgccatgtggagccctggctccagaaaagccaa
accaaccattttccttcctcaggaagaggttcctcaaagccttccctactattcaacact
tggacagagatggatatcacacaacacattcagcaaaggctctggaatcacaagagacac
agggttctacgactccacttcatgtgtcaacagcaaaaaggtagtgagggtcttgagcta
ctgtggcatggcacttcatccttggatactgccttcttgttactttatttcaatgacact
cataaaagtgttttgaaggccaaacttctaactggaagcctggaggaatttatggaaagg
gactcttctcttctcttgcggagggcacggcgagcaggcagtattgcatctaagattcct
ggcccctcccaggaacgtgatgggcctgaaactaaccagtgttccctccatcatttccaa
gtcagtttccaccagctgggctgggatcactggatcattgctcccagtctctatacccca
aactactgtaaaggagcctgccctcgggtactacgctatggtctcaattctcccaatcac
gccattatccagaaccttgtcaatgagctggtgaaccagagtgtccctcagccctcctgt
gtcccttataagtatgttcccattagcatccttatggttgaggctaatgggagtatctta
tacaaggagtatgaggatatgattgcccagtcctgcacatgcaggtga

DBGET integrated database retrieval system