KEGG   Miniopterus natalensis: 107541498
Entry
107541498         CDS       T05883                                 

Gene name
KIF22
Definition
(RefSeq) kinesin-like protein KIF22
  KO
K10403  kinesin family member 22
Organism
mna  Miniopterus natalensis
Pathway
mna04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107541498 (KIF22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107541498 (KIF22)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     107541498 (KIF22)
SSDB
Motif
Pfam: Kinesin Microtub_bd HHH_3 HHH_6 Csm1_N
Other DBs
NCBI-GeneID: 107541498
NCBI-ProteinID: XP_016074065
LinkDB
Position
Unknown
AA seq 665 aa
MDAGVPAQLRRREMAAATSGAGRCRLSKVGAVRRPPPARVRVAVRLRPFVDETSGANDTP
CVRGLDSYSLEIANWRNHQETLKYQFDAFYGERSSQQDIYAGSVQPILRHLLEGQNASVL
AYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKV
LDLLNPASGDLVIREDCRGNILIPGLTQKPISSFADFEQHFLPASRNRTVGATRLNQRSS
RSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINSSLFVL
GKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERCFYLDTVSALNFAAR
SKEVINRPFTNESLQLNVLAPVKLSQKELVGPSEAKRARGPEEEEIGNLEPPAPPASASQ
KFSPLQKLSSMDPAMLERLLSLDRLLGSRGTQGTPLLSTPKRERMVLMKTVEEKDLEIER
LKMKQKELEAKVRAQETVDPKEKENCSPTMLRPLARRTVTVAKPLKKAVVIPLQLIQEQA
ASPNANIHILKKKSRKRKLECLDATESKEIAEDCWELQISPELLANGRQKILDMLNEGSA
RDLRSLQRIGQKKAQLIVGWRELHGPFSQVEDLEHVKVMSGKQLESFLKANILGLAATGQ
HCSPC
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggacgccggagtcccggcgcagctgaggcgacgcgagatggcggcggcgacctcagga
gctggtcgctgtcggcttagcaaggtgggagctgtccggcgcccccctccagctcgagta
agggtggctgtgcggctgaggccatttgtagatgaaacatctggagcaaatgataccccc
tgtgtacggggcctggacagctattctctagagattgccaactggaggaaccaccaggag
actctcaaataccagtttgatgccttctacggggagaggagttctcagcaggacatctat
gctggatcagtgcagcccatcctaaggcacttgctggaagggcagaatgccagtgtgctt
gcctatgggcccacaggggcagggaagacgcacacaatgctgggcagcccagagcaacct
ggagtgattccccgcgctctcatggacctcctacagctcacaagggaggagggtgctgag
ggccggccatgggccctctctgtcactatgtcttacttagagatctaccaggaaaaggta
ttagaccttctgaaccctgcatctggagacctggtgatccgagaagactgtcgaggaaac
atactgattccgggcctcacgcagaagcccatcagtagctttgctgattttgagcagcac
ttcctgccagccagtcgaaatcgaactgtaggagccacccggctcaaccagcgctcctcc
cgaagtcatgctgtactcctggttaaggtggatcagcgggaacgcttggccccatttcgc
cagcgggaggggaaactctacctgattgatttggctggctcagaggacaaccggcgcaca
ggcaacaagggcctgaggctgaaggagagtggagccatcaactcctccctctttgtactg
ggcaaggtggtggatgccctgaaccagggcctccctcgagtgccttaccgggacagcaag
ctcactcgcctgttgcaggactctctgggtggctcagcccacagcatcctcattgccaac
attgcccctgagagatgcttctacctagacacggtctctgcactcaactttgctgccagg
tccaaggaggtgattaaccgaccttttaccaatgagagcctacagcttaatgtcttggca
cctgttaaactgtctcagaaagaactggtaggtccttcagaggcaaagagagctcgaggc
cccgaggaagaggagattggcaatcttgagcccccggcacctccagcctctgcttcccag
aaattcagccccctacagaagctaagtagcatggacccggccatgctagagcgcctgctg
agcttggaccgtctgctgggctcccgggggacccagggaacccctctgctgagcacccca
aagcgagaacgaatggtgctcatgaagacagtagaggagaaggatctggagattgaaagg
cttaagatgaagcaaaaagaactggaagccaaggtgcgggcacaggaaactgtggaccca
aaagaaaaagagaattgctctcccacaatgctccgaccccttgcccgccgcaccgtcaca
gtggctaagcccctcaaaaaggctgtggtgattcccctacaattgattcaggagcaggca
gcatccccaaatgccaacatccatatcctgaagaagaaaagccgcaagagaaagttggag
tgcctggatgccacagagtcgaaggaaattgctgaggactgctgggagctacagatcagc
ccagagctacttgccaatgggcgccaaaaaatactagatatgctgaatgaaggctcagcc
cgggatctgcgcagcctgcagcgcattggccaaaaaaaggcccagctcatcgtgggctgg
agggagctccacggccccttcagccaggtggaggacttggaacatgtgaaggtcatgtca
gggaaacagctggagtctttcctaaaggcgaacatcttgggtcttgccgccacgggccag
cactgcagcccctgctga

DBGET integrated database retrieval system