KEGG   Miniopterus natalensis: 107541524
Entry
107541524         CDS       T05883                                 

Gene name
JUNB
Definition
(RefSeq) transcription factor jun-B
  KO
K09028  transcription factor jun-B
Organism
mna  Miniopterus natalensis
Pathway
mna04380  Osteoclast differentiation
mna04668  TNF signaling pathway
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107541524 (JUNB)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107541524 (JUNB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107541524 (JUNB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107541524 (JUNB)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107541524 (JUNB)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 MAD DUF737 DivIC
Other DBs
NCBI-GeneID: 107541524
NCBI-ProteinID: XP_016074098
LinkDB
Position
Unknown
AA seq 344 aa
MCTKMEQPFYHDDSYAAAGYGRAPGGLSLHDYKLLKPSLALNLTDPYRGLKAPGARGPGP
EGSGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSSGG
AGGVVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPPAGPGGVYAGPEPPPVYT
NLSSYSPASAPSGGGGAAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLGRGSSTFKEEP
QTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTL
KAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgattcatacgcagctgcgggatac
ggccgggccccgggcggcctctctctacacgactacaaactcctgaaacccagcctggcg
ctcaacctgaccgacccttaccgaggtctgaaagcacccggggcgaggggccccggccca
gagggcagcggtggtggcagctacttttccggccagggctcggacacaggcgcgtcgctc
aagctagcctcatcagagctggagcgcctgatcgtccccaacagcaacggcgtgatcacg
acgacgcctacgcctccgggacagtacttttaccctcgcgggggtggcagcagtggaggt
gcagggggcgtcgtcaccgaggagcaggagggtttcgccgacggctttgtcaaagccctg
gacgacctgcacaagatgaaccacgtgacgccccccaacgtgtccctgggcgccagcggg
gggcccccggcggggcccgggggtgtctatgctggcccggagccgcctcctgtctacacc
aacctcagcagctattcccctgcctctgcaccctccggaggcggaggggccgccgtcggg
acaggcagctcgtacccgacggccaccatcagctacctcccacacgcgccgcccttcgcc
ggcggccacccggcacagctgggcctgggccgcggctcctccaccttcaaggaggaaccg
cagaccgtgcctgaggcgcgcagccgcgacgccacgccgccagtgtcccccatcaacatg
gaagaccaggagcgcatcaaagtggagcgcaagcggctgcggaaccggctggcggccacc
aagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtgaagacactc
aaggccgagaatgcgggactctcgagcactgcgggcctcctccgggagcaggtggcccag
ctcaaacagaaggtcatgacccacgtcagcaacggctgccagctgctgctaggggtcaag
ggacacgccttctga

DBGET integrated database retrieval system