KEGG   Miniopterus natalensis: 107541555
Entry
107541555         CDS       T05883                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mna  Miniopterus natalensis
Pathway
mna00250  Alanine, aspartate and glutamate metabolism
mna00410  beta-Alanine metabolism
mna00430  Taurine and hypotaurine metabolism
mna00650  Butanoate metabolism
mna01100  Metabolic pathways
mna04727  GABAergic synapse
mna04940  Type I diabetes mellitus
Module
mna_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107541555 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107541555 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107541555 (GAD2)
   00430 Taurine and hypotaurine metabolism
    107541555 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107541555 (GAD2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107541555 (GAD2)
Enzymes [BR:mna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107541555 (GAD2)
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-GeneID: 107541555
NCBI-ProteinID: XP_016074142
LinkDB
Position
Unknown
AA seq 585 aa
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDSEKPAENGG
SEPPRATSRKAACACNQKPCSCPKADVNYAFLHATDLLPACDGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGYVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSQKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTSGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMSRLSKVAPAIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcttctccgggctccggtttttggtccttcggatctgaagatggctccggggatccc
gagaaccccggcacagccagagcctggtgtcaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgtgctctgctctacggagactcggagaagccggcggagaacggcggg
agcgagcccccgcgggccacctcccggaaggccgcctgtgcctgcaaccagaagccctgc
agctgtcccaaagccgacgtcaactacgcgtttctacacgcaacagacctgctgccagcg
tgtgatggagaaagacccaccttggcgtttctgcaggatgttatggatattttgcttcaa
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttcttcaagaatataattgggaactggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcccagatatttcaat
caactctccactggactggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaatcgctccagtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cccggtggcgccatatcgaacatgtatgccatgctgatcgcacgcttcaagatgttccca
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttgggtattggaacagacagcgtgatt
ctgattaaatgtgatgagagggggaaaatgatcccatctgatcttgaaagaaggatcctt
gaagccaaacaaaaaggatatgttcctttccttgtgagtgccacagctgggaccaccgtg
tatggagcatttgatcccctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcatgtggatgctgcttggggtggcggattgctgatgtcccagaaacacaagtggaaa
ctgagcggcgtggagagggccaactccgtgacatggaatccacacaagatgatgggcgtc
cctttgcagtgctctgctctcctggttagggaagagggactgatgcagagttgcaaccag
atgcacgcctcctacctcttccagcaagataaacattacgacctgtcctacgacactgga
gacaaggccctgcagtgcggacgccacgttgatgtctttaagttatggctcatgtggcga
gcaaaggggacttctgggttcgaagcgcatattgacaagtgtttggagctggcggagtat
ttgtacaatatcataaaaaatcgagaaggatacgaaatggtgtttgatgggaagcctcag
catacaaatgtctgcttctggtatgttcctccgagtttgcgtgtcctggaagacaatgaa
gagagaatgagccgcctctcaaaagtggctccggcgattaaagccaggatgatggagtac
gggaccacgatggtcagctaccagcccttgggggacaaggtcaacttcttccgcatggtc
atttcaaatcccgccgcaactcaccaagacattgacttcctgattgaagaaatagagcgc
ctgggacaagatttataa

KEGG   Miniopterus natalensis: 107546539
Entry
107546539         CDS       T05883                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mna  Miniopterus natalensis
Pathway
mna00250  Alanine, aspartate and glutamate metabolism
mna00410  beta-Alanine metabolism
mna00430  Taurine and hypotaurine metabolism
mna00650  Butanoate metabolism
mna01100  Metabolic pathways
mna04727  GABAergic synapse
mna04940  Type I diabetes mellitus
Module
mna_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107546539
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107546539
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107546539
   00430 Taurine and hypotaurine metabolism
    107546539
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107546539
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107546539
Enzymes [BR:mna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107546539
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1 DegT_DnrJ_EryC1 Aminotran_1_2
Other DBs
NCBI-GeneID: 107546539
NCBI-ProteinID: XP_016080454
LinkDB
Position
Unknown
AA seq 340 aa
MEQITLKKMREIVGWSNKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTQGMAAVPKLVL
FTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNAT
AGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERACSVTWNPH
KMMGVLLQCSAILVKEKGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKF
WLMWKAKGTVGFENQINRCLELAEYLYAKIKNREEFEMVFNGEVAPKIKALMMESGTTMV
GYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagcaaataactcttaagaagatgagagagatagttggatggtcaaataaagatggt
gatgggatattttctcctgggggagccatctccaacatgtacagcatcatggccgcgcgc
tacaagttcttccccgaggtcaagacccagggcatggcggccgtgcccaagctggtcctc
ttcacctccgaacatagccactactccatcaaaaaggccggggctgcgcttggctttgga
accgacaatgtgattttgataaagtgcaatgaaagggggaaaataattcctgctgattta
gaggcaaaaattcttgaagccaagcaaaagggatatgttcctctttatgtcaatgcaact
gctggcacgactgtttatggagcctttgatccgatacaggagattgcagatatatgcgag
aaatacaacctttggctacatgtcgatgctgcctggggcggtgggctgctcatgtccagg
aagcaccgccataaactcagtggcatagaaagggcgtgctcagtgacctggaaccctcac
aagatgatgggcgtgcttctgcaatgctctgccattctcgtcaaggaaaaggggatactc
cagggatgcaaccagatgtgtgcaggctacctcttccagccagacaagcaatatgatgtc
tcttatgacactggggacaaggcaattcagtgcggccgtcacgtggacattttcaagttc
tggctgatgtggaaagcaaagggaacagtgggatttgaaaatcagatcaacagatgcttg
gaactggctgagtacctctatgccaagattaaaaacagagaagaatttgagatggtcttc
aatggtgaggtggctccaaaaatcaaagctctgatgatggagtccggcacgaccatggtt
ggctaccagcctcagggggacaaggccaacttcttccggatggtcatctccaacccagct
gctacccagtctgacatcgacttcctcatcgaggagatagaaagactgggccaggatctt
taa

DBGET integrated database retrieval system