KEGG   Miniopterus natalensis: 107541594
Entry
107541594         CDS       T05883                                 

Gene name
TAPBP
Definition
(RefSeq) tapasin
  KO
K08058  TAP binding protein (tapasin)
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna05163  Human cytomegalovirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107541594 (TAPBP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541594 (TAPBP)
   05168 Herpes simplex virus 1 infection
    107541594 (TAPBP)
   05163 Human cytomegalovirus infection
    107541594 (TAPBP)
   05169 Epstein-Barr virus infection
    107541594 (TAPBP)
SSDB
Motif
Pfam: C1-set Ig_3 ig Med5
Other DBs
NCBI-GeneID: 107541594
NCBI-ProteinID: XP_016074201
LinkDB
Position
Unknown
AA seq 448 aa
MKPLSLLLAVALGLVTAASAGPAVIECWLVEDAGGGRLAKRPAALLLRQGPGGPPPRPDL
DPELYLKVHDPAGALQAALRRYPRSAPAPHCEMSRYVPLPASARWARGLTPEPSCPRALD
GAWLMVSISSRVVSLSSLLRPQSESLPEPALVTMATAVLTVVTHTPTTRARLGQDALLDL
SFAYMPPTPEATASLAPGPPPFGLEWRRQHQGKGHLLLAATPGLSGQIPAARDGAVAFAA
WDDNEPWGPWTGNGTLWLPAVRPSQEGAYMATIHLSYLQGQVALELAVQKPPKVSLTPAP
LVWAAPGEAPPELICLVSHFYPSVGLEVEWELRGPEGTFQEAKGHRWLSALRHHSDGSVS
LSGHLQPAPVTSAQHGARYVCRVHHPSLPTLGRSAEVTLEVAGLSGPSLEDGIGLFLSAF
LLLGLLKALGWAAVYLRTSKESKEKKAQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgaagcccttgtctctactcctcgctgtggctttgggcttggtgaccgcagcgtcggcg
ggccccgcggtgatcgagtgctggctggtggaggacgccggcgggggccgtttggccaag
agacccgctgctctgctgctgcgccagggtccggggggaccaccgccccggcccgacctc
gaccccgagctctaccttaaagtacacgaccccgccggcgccctccaggcggcgctgcgg
cggtacccccggagcgcccccgccccgcactgcgagatgagccgctacgtcccgctcccc
gcctcggcgcgctgggccaggggcctgaccccggagccgagttgcccgcgggccctggac
ggggcttggctcatggtcagcatatccagccgggtggtcagcctctccagcctcctgcga
ccacagtccgagtctctgccggagcctgcgctcgtcaccatggcaacagctgtgctgact
gtcgtcacccacacccctaccactcgagcccgactgggacaggatgctctgctggacttg
agctttgcctacatgcctcccaccccagaggccactgcatctctggccccaggtccccct
ccctttgggctggagtggagacgccagcaccagggtaagggacacctgctcctggctgca
actcctgggctaagtgggcaaatcccagctgcccgagatggggcagtggcatttgctgct
tgggatgataatgagccatggggtccatggactggaaatggaaccctctggctacctgca
gtgcggccctcccaggagggcgcctatatggctaccatacacctgtcatacctgcaaggg
caggtcgctctggagcttgctgtgcagaagccccccaaagtgtccctgacaccagcacct
cttgtatgggctgcccctggggaggcacccccagaattgatctgcctcgtgtcccacttc
tacccctctgtgggcctggaggtggagtgggagctccgaggcccagagggcacctttcag
gaggccaaggggcacaggtggctctcagccctgcgccaccactcggatggctctgtcagc
ctctcagggcacctgcagccagccccggtcacctctgcccagcatggagcacgctatgtc
tgtcgagtccaccatcccagcctgcccaccttgggacgcagcgctgaagtcaccttggag
gtggcaggtctctctggaccctccctggaggatggcataggcctcttcctgtctgcattt
ctgctcctaggactcctcaaggcactgggctgggcagctgtctacctgcgtacttccaag
gagtcaaaggagaagaaagcacagtga

DBGET integrated database retrieval system