KEGG   Miniopterus natalensis: 107541604
Entry
107541604         CDS       T05883                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04141  Protein processing in endoplasmic reticulum
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05160  Hepatitis C
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05216  Thyroid cancer
mna05217  Basal cell carcinoma
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107541604 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107541604 (BAK1)
   04215 Apoptosis - multiple species
    107541604 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541604 (BAK1)
   05202 Transcriptional misregulation in cancer
    107541604 (BAK1)
   05206 MicroRNAs in cancer
    107541604 (BAK1)
   05203 Viral carcinogenesis
    107541604 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107541604 (BAK1)
   05212 Pancreatic cancer
    107541604 (BAK1)
   05225 Hepatocellular carcinoma
    107541604 (BAK1)
   05226 Gastric cancer
    107541604 (BAK1)
   05214 Glioma
    107541604 (BAK1)
   05216 Thyroid cancer
    107541604 (BAK1)
   05220 Chronic myeloid leukemia
    107541604 (BAK1)
   05217 Basal cell carcinoma
    107541604 (BAK1)
   05218 Melanoma
    107541604 (BAK1)
   05213 Endometrial cancer
    107541604 (BAK1)
   05224 Breast cancer
    107541604 (BAK1)
   05222 Small cell lung cancer
    107541604 (BAK1)
   05223 Non-small cell lung cancer
    107541604 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    107541604 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107541604 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107541604 (BAK1)
   05160 Hepatitis C
    107541604 (BAK1)
   05164 Influenza A
    107541604 (BAK1)
   05162 Measles
    107541604 (BAK1)
   05168 Herpes simplex virus 1 infection
    107541604 (BAK1)
   05163 Human cytomegalovirus infection
    107541604 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541604 (BAK1)
   05169 Epstein-Barr virus infection
    107541604 (BAK1)
   05165 Human papillomavirus infection
    107541604 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107541604 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mna03029]
    107541604 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107541604 (BAK1)
Mitochondrial biogenesis [BR:mna03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    107541604 (BAK1)
Transporters [BR:mna02000]
 Other transporters
  Pores ion channels [TC:1]
   107541604 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 107541604
NCBI-ProteinID: XP_016074219
LinkDB
Position
Unknown
AA seq 211 aa
MASGQGPGPPRQGCEEPAQSSTSEEQVAQDTEEVFRSYVFYRHQQELEAEGAAAPADPEM
VALSLEPASTMAQVGQRLAIIGDAINQRYDEEFQTMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALYVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
LDLGNGPIRNVLIVLAVVLLGQLVVRKFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttctgggcaaggaccaggccctccccggcagggatgtgaagagcctgcccagtcc
tctacttcggaggagcaggtagcccaggacactgaggaggttttccgcagctacgttttt
taccgccatcagcaggagctggaagctgaaggggcggctgcccctgctgacccagagatg
gtcgccttgtccctagaacctgccagcaccatggcacaggtgggccagcggctcgccatc
attggggatgccatcaaccagcgctatgacgaggagttccagaccatgttgcagcacctg
cagccaactgccgagaatgcctacgagtatttcaccaagatcgcctccagcctgtttgag
agcggcatcaactggggccgggtggtggctctcctgggcttcggctaccgcctggccctg
tacgtctaccagcacggcctgaccggcttcctgggccaggtgacccgcttcgtggtcgac
tttatgctgcatcactgcattgcccggtggattgcacagaggggcggctgggtggcagcc
ctggacctgggcaacggccccatccggaatgtgctgatagttctggctgtggttctgttg
ggccagcttgtggtacgaaaattcttcaagtcatga

DBGET integrated database retrieval system