KEGG   Miniopterus natalensis: 107541691
Entry
107541691         CDS       T05883                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
mna  Miniopterus natalensis
Pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05206  MicroRNAs in cancer
mna05212  Pancreatic cancer
mna05214  Glioma
mna05218  Melanoma
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107541691 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107541691 (CDK6)
   04115 p53 signaling pathway
    107541691 (CDK6)
   04218 Cellular senescence
    107541691 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107541691 (CDK6)
   05206 MicroRNAs in cancer
    107541691 (CDK6)
   05203 Viral carcinogenesis
    107541691 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107541691 (CDK6)
   05225 Hepatocellular carcinoma
    107541691 (CDK6)
   05214 Glioma
    107541691 (CDK6)
   05220 Chronic myeloid leukemia
    107541691 (CDK6)
   05218 Melanoma
    107541691 (CDK6)
   05224 Breast cancer
    107541691 (CDK6)
   05222 Small cell lung cancer
    107541691 (CDK6)
   05223 Non-small cell lung cancer
    107541691 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107541691 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107541691 (CDK6)
   05164 Influenza A
    107541691 (CDK6)
   05162 Measles
    107541691 (CDK6)
   05163 Human cytomegalovirus infection
    107541691 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107541691 (CDK6)
   05169 Epstein-Barr virus infection
    107541691 (CDK6)
   05165 Human papillomavirus infection
    107541691 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107541691 (CDK6)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107541691 (CDK6)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107541691 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 107541691
NCBI-ProteinID: XP_016074305
LinkDB
Position
Unknown
AA seq 326 aa
MEKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLNKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKTPQPIENFVTDIDEQGKDLLLKCLTFNPAKRISAYGALSHPYF
HDLERRKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgagccgtgcggaccagcagtacgagtgcgtggcggagatcggg
gagggggcctatgggaaggtgttcaaggcccgcgacctgaagaacggaggccgtttcgtg
gcgctgaagcgcgtgcgggtgcagacgggcgaagagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtcgtcaggttattt
gatgtgtgcacggtgtcacgaacagacagagaaactaagctaacattagtgtttgaacat
gttgatcaagacttgaccacttatttgaataaagttccagagcctggagtgcccactgaa
accataaaggacatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtggtgcatcgtgatctaaaaccacagaacattctggtgaccagcagtggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctcttacctcagtggtc
gtcacactgtggtaccgagctcccgaagtcctactgcagtccagctacgccacccccgtg
gacctctggagtgtcggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtggatcaactaggaaagatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcactcaaaaactccccaa
cctattgagaattttgtaacagatattgatgaacaaggcaaagacctacttctgaagtgc
ttgacatttaatccagccaaaagaatatctgcctacggcgccctgtctcacccatacttc
catgacctggaaaggcgcaaggagaacctggattcccacctgcctcccagccagaacagc
tcagagatgaatacagcctga

KEGG   Miniopterus natalensis: 107546223
Entry
107546223         CDS       T05883                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04218  Cellular senescence
mna04530  Tight junction
mna04660  T cell receptor signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05212  Pancreatic cancer
mna05214  Glioma
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107546223 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107546223 (CDK4)
   04115 p53 signaling pathway
    107546223 (CDK4)
   04218 Cellular senescence
    107546223 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107546223 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107546223 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107546223 (CDK4)
   05203 Viral carcinogenesis
    107546223 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107546223 (CDK4)
   05225 Hepatocellular carcinoma
    107546223 (CDK4)
   05214 Glioma
    107546223 (CDK4)
   05220 Chronic myeloid leukemia
    107546223 (CDK4)
   05218 Melanoma
    107546223 (CDK4)
   05219 Bladder cancer
    107546223 (CDK4)
   05224 Breast cancer
    107546223 (CDK4)
   05222 Small cell lung cancer
    107546223 (CDK4)
   05223 Non-small cell lung cancer
    107546223 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107546223 (CDK4)
   04934 Cushing syndrome
    107546223 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107546223 (CDK4)
   05160 Hepatitis C
    107546223 (CDK4)
   05164 Influenza A
    107546223 (CDK4)
   05162 Measles
    107546223 (CDK4)
   05163 Human cytomegalovirus infection
    107546223 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107546223 (CDK4)
   05169 Epstein-Barr virus infection
    107546223 (CDK4)
   05165 Human papillomavirus infection
    107546223 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107546223 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107546223 (CDK4)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107546223 (CDK4)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107546223 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 107546223
NCBI-ProteinID: XP_016080043
LinkDB
Position
Unknown
AA seq 303 aa
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGSGAGGGLPISTVREVALL
RRLEAFEHPNVVRLVDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPCPVQSVIPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacccctcgatatgagccagtggctgagattggtgttggtgcctatgggacggtg
tacaaggcccgtgatccccacagtggccatttcgtggccctcaagagcgtgagagtcccc
aatggaagtggtgccggagggggacttcctatcagcacagttcgtgaggtggccttactg
aggcggctggaagcttttgagcatcccaatgttgtccgactggtggatgtctgtgccaca
gcccgaactgatcgggagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagaccatcaaggatctg
atgcgccagtttctaagaggcctggatttccttcatgccaactgcattgttcaccgagac
ctgaagccagagaatattctggtgacaagtagtgggacagtcaagctggccgactttggc
ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcaatctacatatgcaacacctgtggacttgtggagtgtt
ggctgtatctttgcagaaatgtttcgtcgaaagcctctcttctgcggaaactccgaagct
gaccaattaggcaaaatctttgacctgattggtctgcctccagaggatgactggccccga
gatgtgtctctaccccgaggagccttttctcccagagggccctgcccagtgcagtcagtg
atacctgagatggaggagtctggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgccttccgagctctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system