KEGG   Miniopterus natalensis: 107541765
Entry
107541765         CDS       T05883                                 

Gene name
XDH
Definition
(RefSeq) xanthine dehydrogenase/oxidase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00232  Caffeine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
mna04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107541765 (XDH)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    107541765 (XDH)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107541765 (XDH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107541765 (XDH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107541765 (XDH)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     107541765 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     107541765 (XDH)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   107541765 (XDH)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 107541765
NCBI-ProteinID: XP_016074407
LinkDB
Position
Unknown
AA seq 1333 aa
MTADELVFFVNGKKVVEENADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKSRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTFEEIEDAFQGNLCRCTGYRPILQGFRTFARDGGCCGGNVDNPNCC
MNQKKDHTVSLSPSLFNPEEFMPLDPTQEPIFPPELLRLKDAPQKQLRFQGERVTWIQAS
TLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNMLFPVIISPAWIPELNLVEHGPEGISFG
AACPLSTVEKTLLDAVAELPAYKTEVFRGVLEQLRWFAGKQVKSVASIGGNIITASPISD
LNPVFMASGTKLTIVSRGTRRTVPMDHTFFPGYRKTLLGPEEILLSIEIPYSREGEFFSA
FKQASRREDDIAKVTTGMRVLFEPGTTQVKELALCYGGMADKTISALKTTRKQLSNFWNE
KLLQEVCAGLAEELQLAPDAPGGMVDFRRTLTLSFFFKFYLTVLQKLGKGHPEDKCGELD
PTFASATLLFQKDPPANIQLFQEVPKGQSEEDMVGRPLPHLAAAMQASGEAVYCDDIPHY
ENELSLRLVTSTLAHAKIKSIDISEAQKVPGFVCFISADDIPGSNKTGLANDETVFAKDE
VTCVGHIIGAVVTDTPEHAQRAAQGVKITYEELPAIISIEDAIKHNSFYGAERKIEKGNL
KKGFSEADNVVSGELYIGGQEHFYLETNCTIAVPKGEAGEMELFVSTQNTMKTQSFVANM
LGVPANRITVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGCPVRCMLDRSEDMLITGGR
HPFLARYKVGFMKTGKIVALEVEHYSNAGNTLDLSQGIMDRALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAEHWMSEVAVTCGLPAEEVRQKNMYKEGDLTHFNQKL
EGFTVPRCWDQCLESSQYHARKSEVEKFNRENCWKKRGLCIIPTKFGISFLVPFLNQGGA
LIHVYTDGSVLLTHGGTEMGQGLHTKMVQVASKTLKIPISKIYISETSTSTVPNTSPTAA
SVSTDINGQAVYEACQTILKRLEPFKRKNPNGSWEDWVVAAYQDAVSLSATGFYKTPNLG
YSYETNSGNPFHYFTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELLYSPEGSLLTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIQASRAQHGDNSTKALFRLDSPATPEKIRNACVDKFTTLGVT
DVPENCKPWSQRV
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgaccgcggacgagttggttttctttgtgaatggcaaaaaggtggtggaggaaaatgca
gatccagaaacaacccttttggcctacctgagaagaaagttggggctgagcgggaccaag
ctgggctgtggagaagggggctgtggagcttgcaccgtgatgctctccaagtatgatcgt
ctccagaacaagatcgtccacttttcagccaatgcctgcctagcccccatctgctccttg
caccatgttgccgtgacgactgtggaagggataggaagcaccaagtccaggctgcacccc
gtgcaggagagaattgccaaaagccatggctcccagtgtgggttctgcacccctggcatc
gtcatgagcatgtacacgttgctccggaaccagcccgagcccacctttgaggagatcgag
gatgccttccaaggaaacctgtgccgctgcacgggctacagacccatcctccagggcttc
cgcacctttgccagggatggtggatgctgcggaggaaatgtggacaacccaaactgctgc
atgaaccagaagaaagaccacacagtcagcctctcaccatccttattcaacccagaggag
ttcatgcccttggatcctacccaggagcccatcttccccccagagttgctgaggctgaaa
gacgctccgcagaagcagctgcgtttccaaggggagcgtgtgacctggatccaggcctcg
accctgaaggagctgctagacctcaaagcgcagcaccccgaggccaagctggtggtgggg
aacacggagatcggcattgaaatgaagtttaagaacatgctgtttcctgtgatcatcagc
ccagcctggatccccgagctgaatttagtggagcatggaccagagggtatctcctttgga
gctgcttgccccctgagcactgtggaaaagaccctgctagatgccgttgccgagcttcct
gcctacaaaacagaggtgttcagaggtgtcctggagcagctgcgctggtttgccgggaag
caggtcaagtctgtggcgtccatcggagggaacatcattacggccagccccatctccgac
ctcaacccggtgttcatggccagtgggaccaagctgaccatcgtgtccagaggcactagg
agaacagtcccgatggaccacaccttcttccctggctacagaaagaccctgctgggtccg
gaagagatactgctttccatcgagatcccctacagcagggagggcgagtttttctcagca
tttaagcaggcctcccggagagaggatgacatagccaaggtgaccacgggcatgagagtc
ctgttcgagccaggaaccacacaggtgaaggagctggccctgtgctacggcggcatggcc
gacaaaaccatctcagccctaaagaccactcggaagcagctgtcgaatttctggaacgag
aagctgctgcaggaggtgtgtgcaggcctggcggaggagctgcagctggcccccgacgcc
ccggggggcatggtggacttccggcgcaccctcaccctcagcttcttcttcaagttctac
ctgacggtgcttcagaagctgggcaaagggcacccggaggataagtgtggtgaactggac
cccacctttgccagcgccaccttactctttcagaaagaccctccggccaacatccagctc
ttccaggaggtgcccaagggtcaatctgaggaggacatggtgggccggcccctgccgcac
ctggccgcagccatgcaggcctccggggaggctgtgtactgtgacgacatccctcactac
gagaatgagctgtccctccggctggtcaccagcaccctggcccatgccaagatcaagtcc
atcgacatttcagaagctcagaaggtgccggggtttgtttgctttatctccgccgatgat
attcccgggagtaataaaactggacttgccaatgatgaaacagtctttgcaaaggatgag
gtgacttgcgttgggcacatcattggtgctgtggtcactgacaccccagagcacgcccag
agagcagctcaaggcgtgaagatcacctatgaagaacttccagccattatctccatcgag
gatgcgataaaacacaactccttttatggagccgagcggaagatcgagaaaggaaatctc
aagaaggggttctcagaagcagacaacgttgtttcaggcgagttgtacattggcggccaa
gagcacttctacctggagacgaactgcaccatcgctgtcccaaaaggcgaggcaggggag
atggagctctttgtgtccacacagaacaccatgaagacccagagctttgttgcaaatatg
ttgggggttccagccaaccggatcacagtccgagtgaagagaatgggaggaggctttgga
gggaaggagacccggagcaccgtggtgtctacggcagtggccctggctgcatacaagacc
ggctgccccgtgcgctgcatgctggatcgcagtgaggacatgctcataactggcggcaga
caccccttcttggccagatacaaggttggcttcatgaagacagggaagattgtggccctg
gaggtggagcactacagcaatgcgggcaacaccttggatctctctcagggtatcatggat
cgcgctctattccacatggacaactgctacaaaatccccaacatccggggcaccgggcgg
ctgtgcaagaccaacctgccctccaacacggccttccggggcttcggggggccccagggg
atgctcattgccgagcactggatgagcgaagtcgcggtgacctgtgggctgcctgccgag
gaagtgcggcagaaaaacatgtacaaagaaggggacctgacacacttcaaccagaagctt
gaggggttcaccgtgcccaggtgctgggaccaatgtctagagagctctcagtatcacgct
cggaaaagcgaggtggaaaagttcaacagggagaactgttggaaaaagaggggattgtgc
ataattcctaccaagttcggaatatccttccttgttcctttcctgaaccagggtggagcc
ctgatccatgtgtacacagacggctctgtgctgctgacccacgggggcacagagatgggc
caaggcctgcacaccaagatggtccaggtggccagcaaaactctgaaaatccccatctct
aagatttatatcagcgagaccagcaccagtacagtgcccaacacctctcccacggccgcc
tctgtcagcactgacatcaacggacaggccgtctacgaagcttgtcagaccatcctgaag
aggctggaacccttcaagagaaagaatcccaatggctcctgggaagactgggtcgtggct
gcctaccaggatgcagtgagcttgtccgctactgggttttacaaaacacccaaccttggc
tacagctatgagaccaactcagggaaccccttccactacttcacctacggggtggcttgc
tctgaagtggaaattgactgcttaacaggggaccataagaaccttcgcacagacatcgtc
atggacgttggctccagtctgaaccctgccatcgatattggacaagtggaaggagcattt
gtccagggcctgggcctcttcaccctggaggagctgctctactcccctgaggggagcctg
ctcacccgtggccccagtacctacaagatccctgcatttggcagcatccccattgagttc
agggtgtccctgctccgtgactgtcccaacaagaaggccatttacgcatccaaggctgtc
ggggagccgcccctctttctggctgcctccatcttctttgccatcaaggatgccatccag
gcatcacgagctcagcatggagataacagcacgaaggcgctgttcaggttagacagcccc
gccaccccagagaagatccgcaacgcctgcgtggacaagttcaccaccctgggtgtcact
gatgtaccagaaaactgtaaaccctggtctcagagggtctga

DBGET integrated database retrieval system