KEGG   Miniopterus natalensis: 107541766
Entry
107541766         CDS       T05883                                 

Definition
(RefSeq) cytochrome P450 1B1
  KO
K07410  cytochrome P450 family 1 subfamily B1 [EC:1.14.14.1]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna00380  Tryptophan metabolism
mna00980  Metabolism of xenobiotics by cytochrome P450
mna04913  Ovarian steroidogenesis
mna05204  Chemical carcinogenesis
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107541766
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    107541766
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107541766
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107541766
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107541766
   05204 Chemical carcinogenesis
    107541766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107541766
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     107541766
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP1 family
   107541766
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107541766
NCBI-ProteinID: XP_016074408
LinkDB
Position
Unknown
AA seq 339 aa
MSAVCFGCRYHHEDAEFRELLSHNERFGSTVGAGSLVDVMPWLQRFPNPVRTAFREFQQI
NRNFSSFVLDKFLRHRESFRPGAAPRDMMDACILSVRKEAAEGSRDGGARLDEGYVPSTV
TDIFGASQDTLSTALQWLLILLTRYPDVQARVQAELDQVVGRDRLPGLDDQRQLPYVMAF
LYEAMRFSSFVPVTIPHATTANTSVLGFHIPKDTVVFVNQWSVNHDPQKWPDPETFEPAR
FLGPDGLINKDLASSVMIFSVGKRRCIGEELSKAQLFLFTAILAHQCHFRADPDEPSEMD
FSYGLTIKPKAFKINVTLRESMELLDRAVQTLQAEEECQ
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgagcgccgtgtgcttcggctgtcgctaccaccacgaggacgccgagttccgcgagctg
ctcagccacaacgagaggttcggcagcacggtgggcgcgggcagcctggtggacgtgatg
ccctggctgcagcgcttccccaaccccgtgcgcaccgccttccgggagttccagcagatc
aaccgcaacttcagcagcttcgtcctcgacaagttcctgcggcaccgcgagagcttccgg
cccggcgccgccccccgcgacatgatggacgcctgcatcctgtccgtgcgcaaggaggcg
gccgagggctcgcgcgacggcggcgcgcggctggacgaaggctacgtgccgtctacggtc
accgacatcttcggcgccagccaggacacgctctccaccgcgctgcagtggctgctgatc
ctcctcaccaggtaccctgacgtgcaggctcgggtgcaggcggagctggatcaggtcgtg
ggcagagaccggctgcctggcctggacgaccagcgccagctgccctacgtcatggccttc
ctttacgaggccatgcgcttctccagcttcgtgcccgtcaccatccctcacgccaccact
gccaacacgtctgttctgggcttccacatccccaaggacacggtggtgtttgttaaccag
tggtcagtgaatcatgacccgcagaagtggccggacccggagaccttcgagcccgcccgc
ttcttgggcccggacgggctcatcaacaaggacctggcgagcagcgtgatgatcttctcg
gtgggcaagcggcgctgcatcggggaggagctctccaaggcgcagctcttcctcttcacc
gccatcctggcgcaccagtgccacttcagggccgatcccgacgagccctcggaaatggat
ttcagttacggcctgaccattaagcccaaggcatttaaaatcaacgtcactctccgagag
tccatggagctcctggaccgggctgtccaaacgctgcaagccgaggaggagtgccagtga

DBGET integrated database retrieval system