KEGG   Miniopterus natalensis: 107542103
Entry
107542103         CDS       T05883                                 

Gene name
GHRH
Definition
(RefSeq) somatoliberin
  KO
K05260  growth hormone-releasing hormone
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107542103 (GHRH)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107542103 (GHRH)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 107542103
NCBI-ProteinID: XP_016074801
LinkDB
Position
Unknown
AA seq 106 aa
MLLWVFFLMVLTLSSSCRCSSPSPTLRMPRYADAIFTNSYRKVLGQLSARKLLQDIVSRQ
QAERNQEQGAKARLGRQVDSMWEDQKQMALESILVALLQKHRNPQG
NT seq 321 nt   +upstreamnt  +downstreamnt
atgctgctctgggtgttcttcctcatggtcctaaccctcagcagcagctgccgctgctcc
tcgccctccccgaccctcaggatgccacggtatgcagatgccatcttcaccaacagctac
cggaaggtgctgggccagctgtctgcccgcaagctgctccaggacatcgtgagcaggcag
caggcagagagaaaccaggagcaaggagcaaaggcacggcttgggcgtcaggtggacagc
atgtgggaagaccaaaagcagatggcactggagagcatcctggtggccctgctgcagaag
cacaggaatccccaaggatga

DBGET integrated database retrieval system