KEGG   Miniopterus natalensis: 107542119
Entry
107542119         CDS       T05883                                 

Gene name
SLC32A1
Definition
(RefSeq) vesicular inhibitory amino acid transporter
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
mna  Miniopterus natalensis
Pathway
mna04721  Synaptic vesicle cycle
mna04723  Retrograde endocannabinoid signaling
mna04727  GABAergic synapse
mna05032  Morphine addiction
mna05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107542119 (SLC32A1)
   04723 Retrograde endocannabinoid signaling
    107542119 (SLC32A1)
   04721 Synaptic vesicle cycle
    107542119 (SLC32A1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107542119 (SLC32A1)
   05033 Nicotine addiction
    107542119 (SLC32A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107542119 (SLC32A1)
Transporters [BR:mna02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   107542119 (SLC32A1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 107542119
NCBI-ProteinID: XP_016074818
LinkDB
Position
Unknown
AA seq 526 aa
MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKTEGEPCGEEGAEPPVEGDIHYQRGDGAPLPPSSSKDQAVGAGGEFGGHDKPKITAW
EAGWNVTXAPQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEV
VRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVS
QKSWSIIATALLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKF
YIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAY
LTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFP
ACYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLR
LLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgaccaacgtggccacgtccgtgtccaacaagtcc
caggccaaggtgagcggcatgttcgccaggatgggtttccaggcggccaccgacgaagag
gcggtggggttcgcgcactgcgatgacctggacttcgagcaccgacagggcctgcagatg
gatatcttgaaaaccgagggcgagccctgcggagaggagggcgccgagccgcccgtcgag
ggagacatccattaccagcgcggcgacggcgcgcccctgccgccctcgagctccaaggac
caggccgtgggggctggtggcgagttcgggggccacgacaagcccaagatcaccgcgtgg
gaggcgggctggaacgtgaccntcgctccgcagggcatgttcgtgctgggcctgccctac
gcgatcctgcacggcggctacctggggctgttcctcatcatcttcgccgccgtggtgtgc
tgctacaccggcaagatcctcatcgcctgcctgtacgaggagaacgaagacggcgaggtg
gtgcgcgtgcgggactcctacgtggccatcgccaacgcgtgctgcgcgccgcgcttcccc
acgctgggcggccgcgtggtcaacgtggcgcagatcatcgagctggtgatgacctgcatc
ctgtacgtggtggtgagcggcaacctcatgtacaacagcttccccgggctgcccgtgtcg
cagaagtcctggtcgatcatcgccacggccctgctgctgccctgcgccttcctcaagaac
ctcaaggccgtgtccaagttcagcctgctgtgcacgctggcccacttcgtcatcaacatc
ctggtcatcgcctactgcctctcgcgggcgcgcgactgggcctgggagaaggtcaagttc
tacatcgacgtcaagaagtttcccatctccattggcatcatcgtgttcagctacacgtcg
cagatcttcctgccctcgctggagggcaacatgcagcagcccagcgagttccactgcatg
atgaactggacgcacatcgccgcctgcgtgctcaagggcctcttcgcgctggtcgcctac
ctcacctgggccgacgagaccaaggaggtcatcacggataacctgcccggctccatccgc
gcggtggtcaacatcttcctggtggccaaggcgctgctgtcctacccgctgcccttcttc
gccgccgtcgaggtgctggagaagtcgctgttccaggagggcagccgcgccttcttcccc
gcctgctacggcggcgacggccgcctcaagtcctgggggctgacgctgcgctgcgcgctg
gtggtcttcacgctgctcatggccatctacgtgccgcacttcgcgctgctcatgggcctc
accggcagcctcacgggcgccggcctctgcttcctgctgcccagccttttccacctgcgc
ctgctctggcgcaagctgttgtggcaccaagtcttcttcgacgtcgccatcttcgtcatc
ggcggcatctgcagcgtgtccggcttcgtgcactcgctcgagggcctcatcgaggcctac
cgaaccaacgccgaggactag

DBGET integrated database retrieval system