KEGG   Miniopterus natalensis: 107542143
Entry
107542143         CDS       T05883                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04012  ErbB signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04137  Mitophagy - animal
mna04144  Endocytosis
mna04360  Axon guidance
mna04370  VEGF signaling pathway
mna04510  Focal adhesion
mna04520  Adherens junction
mna04530  Tight junction
mna04540  Gap junction
mna04611  Platelet activation
mna04613  Neutrophil extracellular trap formation
mna04625  C-type lectin receptor signaling pathway
mna04727  GABAergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
mna04810  Regulation of actin cytoskeleton
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04926  Relaxin signaling pathway
mna05100  Bacterial invasion of epithelial cells
mna05135  Yersinia infection
mna05152  Tuberculosis
mna05161  Hepatitis B
mna05163  Human cytomegalovirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05219  Bladder cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107542143 (SRC)
   04015 Rap1 signaling pathway
    107542143 (SRC)
   04370 VEGF signaling pathway
    107542143 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107542143 (SRC)
   04137 Mitophagy - animal
    107542143 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107542143 (SRC)
   04520 Adherens junction
    107542143 (SRC)
   04530 Tight junction
    107542143 (SRC)
   04540 Gap junction
    107542143 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107542143 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542143 (SRC)
   04613 Neutrophil extracellular trap formation
    107542143 (SRC)
   04625 C-type lectin receptor signaling pathway
    107542143 (SRC)
   04062 Chemokine signaling pathway
    107542143 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107542143 (SRC)
   04915 Estrogen signaling pathway
    107542143 (SRC)
   04917 Prolactin signaling pathway
    107542143 (SRC)
   04921 Oxytocin signaling pathway
    107542143 (SRC)
   04926 Relaxin signaling pathway
    107542143 (SRC)
   04919 Thyroid hormone signaling pathway
    107542143 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    107542143 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107542143 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    107542143 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107542143 (SRC)
   05203 Viral carcinogenesis
    107542143 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    107542143 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107542143 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107542143 (SRC)
   05152 Tuberculosis
    107542143 (SRC)
   05100 Bacterial invasion of epithelial cells
    107542143 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107542143 (SRC)
   05168 Herpes simplex virus 1 infection
    107542143 (SRC)
   05163 Human cytomegalovirus infection
    107542143 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107542143 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107542143 (SRC)
   01522 Endocrine resistance
    107542143 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107542143 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107542143 (SRC)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107542143 (SRC)
Protein kinases [BR:mna01001]
 Non-receptor tyrosine kinases
  SRC family
   107542143 (SRC)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107542143 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    107542143 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107542143 (SRC)
  Macropinocytosis
   Kinases
    107542143 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 107542143
NCBI-ProteinID: XP_016074862
LinkDB
Position
Unknown
AA seq 537 aa
MGSNKSKPKEASQRRRSLEPAENAHGGGSGGAFPTSQTPSKPASADGHRGPNTAFSPAAA
EPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEG
DWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRE
SETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADG
LCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGK
YLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVE
RGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggaggccagccagcggcgccgcagcctggagcct
gcggagaatgcccatggtggcggcagtgggggtgccttccccacctcacagacccccagc
aagccagcctctgctgatggccaccgtggccccaacacggccttctcccctgccgctgct
gagcccaagctgttcggaggcttcaactcctcggacacagtcacctccccgcagagggcg
gggcccctggctggtggagtgaccacctttgtggccctctatgactatgagtcacggaca
gagactgacctatccttcaagaaaggggagcggctccagattgtcaacaacacagaggga
gactggtggctggcccactcgctcagcacaggacagacgggctacatccccagcaactac
gtggcgccctccgactccatccaggctgaggagtggtactttggcaagatcacaagacga
gagtcagagcggctactgctcaatgcggagaacccaagagggaccttcctagtgcgagaa
agcgagaccacgaaaggtgcctactgcctctcagtgtccgactttgacaacgccaagggc
ctcaatgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctct
cgcacccagttcaacagcctgcagcagcttgtagcctactactcgaaacatgccgatggc
ctgtgccaccgactcaccactgtgtgccccacatccaagccacagactcagggcctggcc
aaggacgcctgggagattccccgggagtcactgcggctggaggtcaagctgggccagggc
tgctttggagaggtgtggatggggacctggaacggcaccaccagggtggccatcaaaacc
ctgaagccaggcacgatgtctccagaggccttcctgcaggaggctcaggtcatgaagaaa
ctgaggcatgagaaactggtgcagctgtacgccgtggtgtctgaggagcccatctacatc
gtcacagagtacatgagcaaggggagtttgctggactttctcaagggggagacgggcaag
tacctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcatac
gtggagcggatgaactatgtccaccgggacctccgtgccgccaacatcctggtcggagag
aacctcgtgtgcaaagtggctgacttcggcctggctcggctcatcgaagacaacgagtac
acagctcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctat
gggcggttcaccatcaagtccgatgtgtggtcctttgggatcttgctgacagagctcaca
acaaagggacgggtgccctaccctgggatggtaaaccgtgaggtgctggaccaggtggag
cgaggctaccggatgccctgcccacctgagtgccccgagtccctgcacgacctcatgtgc
cagtgctggcggaaggagccagaggaacggcccaccttcgagtacctgcaggccttcctg
gaggactatttcacgtccactgagccccaatatcagcctggagagaacctatag

DBGET integrated database retrieval system