KEGG   Miniopterus natalensis: 107542170
Entry
107542170         CDS       T05883                                 

Gene name
ANO1
Definition
(RefSeq) anoctamin-1
  KO
K19496  anoctamin-1
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107542170 (ANO1)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107542170 (ANO1)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 107542170
NCBI-ProteinID: XP_016074890
LinkDB
Position
Unknown
AA seq 1068 aa
MEETALDPLLAEPPEDQAPLSWSPRAAAPRSRAMLEGDIGLEGLNPEEDPAPRESPGPRG
RLLNSLSVDPDARCKYGLYFRDGKRKVDYVLVYHHKRPSGSRTLARRVLQNDAALGARGR
QDRLPWPRGGRQQRRHDLPLFPEAPGCYAMLLLSRHCSEHGSVDVSPGSRSHFLRPCSRK
WDCWATGQLWFSFCAAQALTRSLLASVPPSVKGPPGSPLFRETQPPEPPARRGLRALSRG
AGEVTDPDKLPGPTLTENPFPLQTKIHGVGFVKIHAPWNVLCREAEFLKLKMPTKKLYHI
NEPRGLLKKINSVLQKITDPIQPRVAEHRPQSMKRLSYPFSREKQHLFDLSDKDSFFDSK
TRSTIVYEILKRTTCAKAKYSMGITSLLANGVYSAAYPLHDGDYEGENVEFNDRKLLYEE
WASYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASVVGVIVFLYGCATVDDNI
PSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSIFMALWAATFM
EHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESKNKETDKVKLTWR
DRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVI
LNLVVIILLDEVYGCIARWLTRIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKG
RFVGRPGDYVYIFRSFRMEECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFI
RYLRLKRQSPADQSEHLKRKQRYEADFTLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAP
LFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGVGKLAVIINAFVISFTSD
FIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQDGTAPNDPLDLGYEVHICRYKDYREP
PWSEHKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQVHKQKVLM
VELFMREEQGKQQLLDTWMERAPRKDAPCNNHSPGAGQDGPEYRGGAL
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggaggagacggcgctggaccctctgctggcagagccccccgaagaccaagcccccctc
tcctggagcccgcgcgccgcggcgccccggagccgagccatgctggagggcgacatcggc
ctcgaggggctgaaccccgaggaggaccctgcaccccgtgagtctccagggccccgcggg
aggctgctgaactcgctgtccgtggaccccgacgccaggtgcaagtacgggctgtacttc
cgcgacggcaagcgcaaggtggactacgtgctggtctaccaccacaagaggccctcgggc
agcaggaccctggccaggagggtgctgcagaacgacgccgcgctgggcgcccgcggccgc
caggaccgtctcccgtggccccgtggaggtcgccagcagcgccgacatgacctgcctttg
ttccccgaggcccccgggtgctacgccatgctgctcctgagcaggcattgcagtgaacat
gggagcgtggatgtgtctccaggctccagatcccacttccttcggccatgttcccggaag
tgggattgctgggccacagggcagctctggttttcattctgcgcagcccaggccctgact
cggtctctcctagcctccgtgcccccctctgtgaagggccctcctggctcccctctgttc
cgcgagacccagccgcctgagccacctgccaggaggggactcagagccctgtccagaggg
gcgggtgaggtgacggatcctgacaaactgcctggtcccacgctgactgagaaccccttt
cccctccagactaagatccacggcgtggggtttgtgaagatccacgcgccctggaacgtg
ctgtgcagagaggcggagtttctgaagctgaagatgccgaccaagaagctgtaccacatc
aacgagccccggggcctcctgaaaaaaatcaactccgtgctccagaagatcacagacccc
atccagccccgggtggcggagcacaggccccagtccatgaagagactctcctaccccttc
tccagggagaagcagcacctattcgacctgtctgacaaggattccttttttgacagcaaa
acccggagcacaatagtctacgagattctgaaaagaacaacctgtgcgaaggccaagtac
agcatgggcatcacgagcctgctggccaatggcgtttactcggcggcctaccccctgcac
gatggagactatgagggtgagaacgtggagttcaacgacaggaaactcctgtacgaagag
tgggcgagctatggcgtcttctacaagtaccagcccatcgacctggtcaggaagtacttt
ggggagaagatcggcctatacttcgcctggctgggcgtgtacacccagatgctcatccct
gcgtccgtggtcggggtcatcgtcttcctctacggatgcgccaccgtcgatgacaacatc
cccagcatggagatgtgcgaccagagacacaacatcaccatgtgcccgctgtgcgacaag
acctgcagctactggaagatgagctcggcctgcgccacggcccgcgccagccacctgttc
gacaacccggccactgtcttcttctccatcttcatggccctctgggccgccaccttcatg
gagcactggaagcggaaacagatgcggctcaactaccgctgggacctcaccggcttcgaa
gaggaggaggaggccgtcaaggaccaccccagggccgagtatgaagctagagttctggag
aagtcacttaggaaagaatccaagaacaaagagaccgacaaggtgaagctgacctggaga
gaccggttcccagcctacttcaccaacttggtgtccatcatcttcatgatcgcggtgacc
ttcgccatcgtcctcggcgtgatcatctacaggatctccaccgccgccgccttggccatg
aactcctcgccctccgtgcggtccaacatccgggtcacggtcacggccacggcggtcatc
ctcaacctggtggtcatcatcctgctggacgaggtctacggctgcatcgcccgctggctc
acgaggatcgaggtcccgaagaccgagaagagcttcgaggagaggctcatcttcaaggcc
ttcctgctgaagttcgtcaattcctacacccccatcttctacgtggctttcttcaagggc
cggttcgtggggcgcccgggcgattacgtgtacatcttccggtcgttccgcatggaagag
tgcgccccggggggctgcctgatggagctctgcatccagctcagcatcatcatgctgggc
aagcagctcatccagaacaacctcttcgagatcggcatcccgaagatgaagaagttcatc
cgctacctgcggctgaagcgccagagccccgccgaccagagcgagcacctgaagaggaag
cagcggtacgaggcggacttcacgctggagcccttcgcgggcctcaccccggagtacatg
gagatgatcatccagtttggcttcgtcaccttgtttgtggcgtccttccccctggccccc
ctgttcgcgttgctgaataacatcatcgagatccgcctagatgccaagaagtttgtcacg
gagctgcgcaggccggtggccgtcagagccaaagacatcggaatctggtacaacattctc
agaggcgtcgggaagcttgccgtcatcatcaacgcgtttgtgatctccttcacgtccgac
ttcatcccccgcctggtgtacctctacatgtacagcaagaacgggaccatgcacggcttc
gtcaaccataccctctcctccttcaacgtcagcgacttccaggatggcacagcccccaac
gaccccctggacctgggctacgaggtgcacatctgcaggtacaaagactaccgggagccc
ccgtggtcggaacacaagtacgacatctccaaggacttctgggccgtcctggcggcgcgg
ctggccttcgtcattgtcttccagaacctggtcatgttcatgagcgacttcgtggactgg
gtcatcccggacatccccaaggacatcagccagcaggtccacaagcagaaggtgctcatg
gtcgagctgttcatgcgggaggagcagggaaagcagcagctgctggacacgtggatggag
agggccccgaggaaggacgcgccctgcaacaaccacagccccggagccggccaggacggc
cccgagtaccgcgggggggccctgtag

DBGET integrated database retrieval system