KEGG   Miniopterus natalensis: 107542171
Entry
107542171         CDS       T05883                                 

Gene name
FADD
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04217  Necroptosis
mna04620  Toll-like receptor signaling pathway
mna04621  NOD-like receptor signaling pathway
mna04622  RIG-I-like receptor signaling pathway
mna04657  IL-17 signaling pathway
mna04668  TNF signaling pathway
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05132  Salmonella infection
mna05142  Chagas disease
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107542171 (FADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107542171 (FADD)
   04215 Apoptosis - multiple species
    107542171 (FADD)
   04217 Necroptosis
    107542171 (FADD)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107542171 (FADD)
   04621 NOD-like receptor signaling pathway
    107542171 (FADD)
   04622 RIG-I-like receptor signaling pathway
    107542171 (FADD)
   04657 IL-17 signaling pathway
    107542171 (FADD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542171 (FADD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107542171 (FADD)
   05022 Pathways of neurodegeneration - multiple diseases
    107542171 (FADD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107542171 (FADD)
   05152 Tuberculosis
    107542171 (FADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107542171 (FADD)
   05161 Hepatitis B
    107542171 (FADD)
   05160 Hepatitis C
    107542171 (FADD)
   05164 Influenza A
    107542171 (FADD)
   05162 Measles
    107542171 (FADD)
   05168 Herpes simplex virus 1 infection
    107542171 (FADD)
   05163 Human cytomegalovirus infection
    107542171 (FADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107542171 (FADD)
   05169 Epstein-Barr virus infection
    107542171 (FADD)
   05165 Human papillomavirus infection
    107542171 (FADD)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107542171 (FADD)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107542171 (FADD)
SSDB
Motif
Pfam: Death tRNA_NucTran2_2 ZapA SIKE
Other DBs
NCBI-GeneID: 107542171
NCBI-ProteinID: XP_016074891
LinkDB
Position
Unknown
AA seq 153 aa
MGAPGRPALADASASPVSAHTPQSLWSVILSFPPLDLCAAFDIICDHVGKDWRRLARQLK
VSDSKIDAIEVKYPRNLTEQVRESLRVWKSSSGENAAAAHLVEALRACRLNLVADLVEED
QQARGLQRENESTGSTLSLMSWDLDTPTSGVSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggcgcgcccggcaggcctgccctcgctgatgccagcgcgtcacctgtgagtgctcac
acaccccaaagcctctggtcagtcatcttgtccttccctcccctagacctctgtgcagcg
tttgacatcatatgtgaccacgtggggaaggactggagacgactggcccgtcagctcaaa
gtgtctgactccaagatcgacgccatcgaggtgaagtatccccggaacctgacagaacag
gtgcgggagtcgctgcgtgtctggaagagctcctcgggggagaacgcagccgcagcccac
ttggtggaggcgctgcgggcctgccggctcaacctggtggcggacctcgtcgaggaggac
cagcaggcccggggcctccagcgcgagaacgagagcaccggcagcacactgtccctcatg
tcctgggacttggacacccccacgtcaggagtctcctcctga

DBGET integrated database retrieval system