KEGG   Miniopterus natalensis: 107542321
Entry
107542321         CDS       T05883                                 

Gene name
PNPLA2
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 2
  KO
K16816  patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
mna  Miniopterus natalensis
Pathway
mna00561  Glycerolipid metabolism
mna01100  Metabolic pathways
mna04714  Thermogenesis
mna04923  Regulation of lipolysis in adipocytes
Module
mna_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107542321 (PNPLA2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107542321 (PNPLA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107542321 (PNPLA2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     107542321 (PNPLA2)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 107542321
NCBI-ProteinID: XP_016075088
LinkDB
Position
Unknown
AA seq 401 aa
MAPKRSAGVPQQDTVVLSRSGGTPPTISNLVGAARPVRLLGCTGLWWWGAISWGALRHWA
WSHRGVLPPDPWPAAPGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLMKTLPADS
HERASGRLGISLTRVSDGENVIIYHFNSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVD
GGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKAL
FPPEPMVLREMCKQGYRDGLRFLRRNGLLDRPNPLLALPSAKPPTHQEEEEAVMAVERAR
VEDHILDHLPARLNEALLEACVEPKDLLTTLSNMLPVRLATAMMMPYTLPLESAVSFTIR
LLEWLPDVPEDIRWMKEQTGSICQYLVMRAKRKLGSHLPSR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcccccaagaggagtgcgggggtgccgcagcaggacacagtcgtgctttccaggagt
ggtggaaccccacccactatttccaaccttgttggtgccgcaaggcctgtgcgactcctg
ggctgcactgggctttggtggtggggtgccatcagttggggtgccctgagacactgggca
tggagccataggggtgtgctgccccctgacccttggcctgctgccccaggtgaggccggt
gccaacatcatcgaggtgtctaaggaggcccggaagcggttcctgggcccgctgcacccc
tccttcaacttagtgaagaccatccgaggctgcctgatgaagaccctgcctgctgacagc
catgagcgcgccagcgggcgcctgggcatctccctgacccgcgtctcggacggcgagaat
gtcattatataccacttcaactccaaagatgagcttatccaggccaatgtctgcagcacc
ttcatccccgtgtactgtggtctcatcccacccaccctccagggtgtgcgctatgtggat
ggtggcatctcagacaacctgccgctctacgagctcaagaatacaatcacagtgtccccc
ttctcgggcgagagtgatatctgcccgcaggacagctccaccaacatccacgagctccgg
gtgaccaacactagcatccagttcaacctgcgcaacctttaccgcctctccaaggccctg
ttcccgcccgagcccatggtgctgcgggagatgtgtaagcagggctacagggatggcctg
cgcttcctgcgaaggaatggcctcctggacaggcccaaccccctgctggcactgccctct
gccaagccccctacccaccaggaagaggaggaagctgtgatggctgtggagagggctcga
gtggaagatcacatcctggatcatctgcctgctcggctcaatgaggccctgctggaggcc
tgtgtggagcccaaggacctgctgaccacactgtccaacatgctgccggtgcggctggcc
acggctatgatgatgccctacactctgcccctggagagcgctgtgtccttcactatccgc
ttgctggagtggctgcccgacgtccccgaggacatccggtggatgaaggagcagacgggc
agcatctgccagtacctggtgatgcgcgccaagaggaagctgggcagccacctgccctcc
aggtga

DBGET integrated database retrieval system