KEGG   Miniopterus natalensis: 107542328
Entry
107542328         CDS       T05883                                 

Gene name
ANO9
Definition
(RefSeq) anoctamin-9
  KO
K19503  anoctamin-9
Organism
mna  Miniopterus natalensis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107542328 (ANO9)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107542328 (ANO9)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer 7TM_GPCR_Srz
Other DBs
NCBI-GeneID: 107542328
NCBI-ProteinID: XP_016075095
LinkDB
Position
Unknown
AA seq 776 aa
MQGEERLQILVGMEGDSFPLMEMGASEPDPPDQWDYVLVADHRTQTNPRQVYQQQQFLKD
LKGKGFQYKVRKDQEKVFFGIRADNRIFSLYQMLLMEPKGPAPRVETTRSIPIPDTTSLR
IRIVDFILNSKTKAGDTFQDLVKDGVFETRFPVHKGEENLKKKWARWRNMVHEQPIDDIR
NYFGEKVALYFAWLGWYTYMLVPAAVVGLTVFLSGLSLFNASQISKEICEAHDVFMCPRG
DHGRRYQRLSDTCTFAKLTHLFDNEGTVIFAIFMALWATVFLEFWKRQRARVVLHWDLYG
WDEDQEEVALELINCPDYKLQQHQHSYMRSTIILALSLFMICLMIGMAHVLVVYRVLAAA
LFSNSALPFLEEQVTTAVVVTGALVHYVTILIMTKINKCVALKLCDFEKSRTFSERESKF
TVKFFTLQFFAHFSSLVYIAFILGRINGHPGKSVRLAGLWKLEECHLSGCMMDLFVQMAI
IMGLKQTLSNCMEYLGPWLAHKYRSMRGSESQDPELRNWQRNYRLNPVNTFSLFDEFMEM
MIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVRLRRRLVPRKAKDIGTWLQVLET
IGVLAVIANGMVIAFTSEFIPRVVYKYRYGPCRGGAHSSVDCLTGYINHSLSVFHTKDFQ
DPVKIEGSENVTECRYRDYRNAQDYNFSEQFWVLLAIRLAFLILFEHVALCIKLVAAWFV
PDVPQSVKNRVLEDKYQMLRDRMCYGGSRLQCEPGLGPGATNATPTSSSSLKSTDV
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgcagggtgaagagagactccagatcctggtggggatggaaggtgacagcttcccgctg
atggagatgggtgcttctgagcctgatcctcctgaccagtgggactacgtccttgtggcc
gatcatcgcacccagacaaaccccaggcaggtctaccagcagcagcaattcctgaaggac
ctcaaaggaaagggcttccaatacaaggtgaggaaggaccaggagaaggtgttctttgga
atcagagccgacaataggatcttcagcctgtaccagatgctcctcatggagcccaagggt
ccagcccccagagtggagacaaccaggtcgatccccatcccagacaccaccagcctcaga
atccgaatcgtcgacttcatcctgaacagcaagacgaaagccggtgacacattccaggac
ttggtgaaggatggggtctttgagaccaggtttcccgtgcacaagggggaggaaaacctg
aagaagaaatgggcccggtggagaaacatggtccatgagcagcccattgatgatatcagg
aactacttcggcgagaaggtggccctgtacttcgcctggctcggctggtacacctacatg
ctggtccccgccgcggtggtgggcctcacggtcttcctgagcggcctctcgctgttcaac
gccagccagatcagcaaggagatctgtgaggcccacgacgtcttcatgtgcccacgcggc
gaccacggccgcaggtaccagcgcctctcggacacctgcacctttgccaagctcacccac
ctctttgacaacgagggcactgtgatatttgccatcttcatggctctgtgggccacggtg
ttcctggagttctggaagaggcagcgagcccgcgtggtgctgcactgggacctgtacggg
tgggatgaagaccaggaggaagtggcgcttgagctcattaactgccccgactacaagctc
cagcagcaccagcactcctacatgagaagcaccatcatcctcgccctgtccctgttcatg
atctgcctcatgatcggcatggcccacgtcctggtggtctaccgtgtcctggctgccgct
ctcttcagcaactcggccttgcccttcctggaggagcaggtgaccacggccgtggtggtg
accggggccctggtgcactatgtgaccatcctcatcatgactaagatcaacaagtgtgtg
gccctgaaactttgtgactttgagaagtcccggaccttctcggagcgagagagcaagttc
accgtcaagttcttcactctgcagttctttgcacacttctcctcacttgtctacatcgcc
ttcatcctgggcaggatcaacggtcaccctgggaagtccgtgcgcctggcgggcctgtgg
aagctggaggagtgccacctcagcggatgcatgatggacctatttgtgcagatggccatc
atcatgggcctgaaacagacgctcagcaactgcatggagtacctgggcccgtggctggcc
cacaagtatcgctcaatgcggggcagcgagtcccaggaccccgagctgaggaactggcag
cgcaactatcgcctgaacccagtcaacaccttcagcctgtttgacgagttcatggaaatg
atgatccagtacggcttcaccaccatctttgtggccgccttcccgctggctccgctgctc
gcactcttcagtaacctcgtggagatccgcctggacgccatcaagatggttaggctgagg
cgacgcctggtgccacgcaaggccaaggacatcgggacctggctgcaggtgctggagacc
attggcgtgctggcggtcattgccaacgggatggtcatcgccttcacatctgagttcatc
cccagagtggtatacaagtaccgctatggcccatgccgagggggggcccactcttctgtc
gactgcctcactggctacatcaaccacagtctgtccgtgtttcacaccaaggacttccag
gaccctgtcaagatagagggctcagagaacgtcactgaatgcaggtaccgggactaccgc
aacgctcaggactacaacttctcggaacagttctgggtcctcctggccatccgcctggcc
tttctcatcctctttgagcatgtggccttgtgcatcaagctcgtggccgcctggttcgtg
cctgacgtcccgcagtcggtgaagaacagggttctggaggataagtaccagatgctgcgg
gacaggatgtgctacggggggtccaggctgcagtgtgagcccggcttaggccctggggcc
accaacgccactcctacctccagctccagcctcaagagcacagatgtgtaa

DBGET integrated database retrieval system