KEGG   Miniopterus natalensis: 107542528
Entry
107542528         CDS       T05883                                 

Definition
(RefSeq) steroid 17-alpha-hydroxylase/17,20 lyase
  KO
K00512  steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04913  Ovarian steroidogenesis
mna04917  Prolactin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Module
mna_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
mna_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107542528
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107542528
   04917 Prolactin signaling pathway
    107542528
   04927 Cortisol synthesis and secretion
    107542528
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107542528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107542528
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     107542528
    1.14.14.32  17alpha-hydroxyprogesterone deacetylase
     107542528
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP17 family
   107542528
SSDB
Motif
Pfam: p450 DUF2714
Other DBs
NCBI-GeneID: 107542528
NCBI-ProteinID: XP_016075332
LinkDB
Position
Unknown
AA seq 508 aa
MWELLAVLLLSLAYFFWPKVKSSGAKYPKSLPSLPLVGSLPFLPRNGHPHVNFFKLQEKY
GPIYSFRMGSKTTVMIGHHQLAKELLIKKGKEFSGRPQMITLDILSDEQKGIAFADYGAA
WQLHRKLVLATFALFKDGNQKLENIICQEISSFCDFLATQNGQSIDLCLPLFLTVTNIIC
LICFNTSYKKEHPVMKTIQTYNDGIMDSLGKDSMVDIFPKLKIFPNKTLETMKNCIKMRN
DLLSEIYEKHKKNFSNDSVTNLVDILIQAQMNSSNNNAGSDQHAKLLSDRHILATIGDIF
GAGLETTTSVVKWTVAFLLHNPQLQKKIQEEIDQNVGFSRTPTISDRNHLVLLEATIREV
LRIRPVAPTLIPHKAIVDSSIGEFAIDKGTNVIVNLWALHHSEKEWHLPDQFMPERFLDP
TGSQLISPSSSYLPFGAGPRSCVGENMARQALFLFMSWMLQRFDLEVPDDGQLPSLEGSP
NLVFLINSYKVKIKTRQAWKEAQVEGSA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgtgggaactcttggctgtcttgctgctctccctggcctattttttttggcccaaggta
aagagctctggtgcgaaataccccaagagcctcccatccctgcccttggtgggcagcctg
ccattcctccccagaaatggccatccacacgtgaacttcttcaagctgcaggaaaaatac
ggccccatctattcctttcgtatgggtagcaagactacagtgatgatcggccaccaccag
ctggccaaggagctgcttatcaagaagggcaaggaattctccgggaggccccaaatgatt
actctagatatcctgtcagacgagcaaaagggcattgcctttgccgactatggtgccgct
tggcagctgcatcggaagctggtgctggccaccttcgccttgttcaaggatggcaaccag
aagctagagaacatcatatgtcaagaaatcagttcgttttgtgatttcctggccacccag
aatggacagtccatagatttgtgcttgcctctcttcttgacggtgaccaacataatctgc
ttgatctgctttaacacctcctacaagaaagaacatcctgtgatgaagaccatacagaca
tacaatgatggcatcatggattctctgggcaaggacagtatggtagacatattccccaag
ctgaagattttccccaacaaaaccctggaaacaatgaagaattgtatcaaaatgcgaaat
gacttgctgagtgaaatctatgaaaaacataagaagaacttcagcaatgactctgtcact
aacttggtggacatactgattcaagcccagatgaactcaagcaacaacaatgctggctca
gaccagcatgcaaagctgctttcagatcgacacattcttgctaccataggggacatcttt
ggggccggtttggagaccaccacctctgtggtgaagtggactgtggccttcctgctgcac
aatcctcagttgcaaaagaagatccaggaggagattgaccagaatgtaggttttagccgc
acaccaaccatcagtgaccggaaccacctcgtcctgctggaggccaccatccgagaggtg
cttcgcattcgtcccgtggcccctacgctcatcccccacaaggccatcgttgactccagc
atcggcgagtttgccattgacaagggcacaaatgttatcgtcaatttgtgggctctgcat
cacagtgagaaggaatggcacctgcccgaccagttcatgcccgagcgcttcctggacccc
acggggagccagctcatctcgccatcctcaagctacttgcccttcggagcaggaccccgc
tcctgcgtaggagagaacatggcccgccaggcgctctttctcttcatgtcctggatgctg
cagaggttcgacctggaggtcccggatgatgggcagctgccctccctggagggcagcccc
aatttggtctttctgatcaactcttacaaagtgaagattaagacgcgccaggcctggaag
gaagcccaggtggagggtagcgcttag

DBGET integrated database retrieval system