KEGG   Miniopterus natalensis: 107542666
Entry
107542666         CDS       T05883                                 

Gene name
TAP2
Definition
(RefSeq) antigen peptide transporter 2
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
mna  Miniopterus natalensis
Pathway
mna02010  ABC transporters
mna04145  Phagosome
mna04612  Antigen processing and presentation
mna05163  Human cytomegalovirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107542666 (TAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107542666 (TAP2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107542666 (TAP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107542666 (TAP2)
   05168 Herpes simplex virus 1 infection
    107542666 (TAP2)
   05163 Human cytomegalovirus infection
    107542666 (TAP2)
   05169 Epstein-Barr virus infection
    107542666 (TAP2)
  09163 Immune disease
   05340 Primary immunodeficiency
    107542666 (TAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107542666 (TAP2)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    107542666 (TAP2)
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_29 AAA_21 AAA_23 AAA_25 SMC_N AAA_15 AAA_16 AAA_22 AAA_18 SRP54
Other DBs
NCBI-GeneID: 107542666
NCBI-ProteinID: XP_016075581
LinkDB
Position
Unknown
AA seq 408 aa
RLLQLSRPDLPALAAAFFFLVLAVLGETFIPYYSGRVIDILGGDFDPDAFASAILFMCLF
SVGSSLSAGCRGGCFVFTMSRINLRIREQLFASLLRQDLGFFQETKTGELNSRLNSDTKL
MSSWLPLNANLLLRSLVKVVGLYSFMLSLSPRLTLLSLLEVPLTIAAEKVYNARHQALLL
ETQDEVAQAGQVVREAVGGLPTVRSFGAEEHEACRYEEALERCRKLRWRGNLECALYLLF
RRMLHLVMQVLMLSCGLQQILAGALTRGGLLSFLLFQEDVGHYVQTLVYMCGDMLSNVGA
AEKVFSYLDRRPNLPPPGTLEPAALRGLVEFQDVSFAYPSRPDQPVLKGLTFTLRPGEVT
ALLGPNGSGKSTVAALLQNLYQPTAGKLLLDGEPLPQYEHRYLHRQGV
NT seq 1227 nt   +upstreamnt  +downstreamnt
cgcctgctgcagctctccaggcccgacctgccggcgctcgccgccgccttctttttcctg
gtgctcgcggtgctgggtgagacgttcatcccttactactccggtcgcgtgatcgacatc
ctgggtggtgactttgaccccgacgccttcgccagcgccatccttttcatgtgccttttc
tccgtcgggagctcactgtctgcaggctgccggggaggctgcttcgtcttcactatgtcc
agaatcaacttgcggatccgggagcagctctttgcctctcttcttcgccaggaccttggt
ttcttccaggagactaagacaggggagctgaattcccggctgaactcggataccaagctg
atgagttcctggcttcctttaaatgccaatttgctcctgcggagcctggtgaaagtggtg
ggactgtacagcttcatgctcagcctgtcgccccgactcaccctgctgtccctgctcgag
gtgcctctcacgatagcggctgaaaaggtgtacaatgcccgccatcaggccttgcttctg
gagacccaggacgaggtggcgcaggccgggcaggtggtgcgggaggccgtcggagggctg
ccgaccgtgcgcagctttggggctgaggagcacgaggcctgtcgctatgaggaggccctg
gaacggtgccggaagctgcggtggcggggaaacctggaatgcgccctctacctgctcttc
cgcaggatgctgcacctggtgatgcaggtgctgatgctcagctgcgggctgcagcagatc
ctggccggggccctcacccggggcgggctgctgtcctttctgctcttccaggaagacgtg
ggtcactacgtgcagaccctggtgtacatgtgcggggatatgctgagcaacgtgggggcg
gccgagaaggttttcagctacctggacagacggccgaacctgcccccgccggggactctg
gagcccgccgcgctgcgcgggctggtggagttccaggacgtgtcctttgcgtaccccagc
cgcccggaccagcccgtgctcaaggggctgacgttcacgctgcggcccggcgaggtgacg
gcgctgctggggcccaacgggtccgggaagagcacggtggcggccctgctgcagaatctg
taccagcccacggcggggaagctgctgctggatggggagccccttccccagtatgagcac
cgctacctgcaccggcagggtgtctga

KEGG   Miniopterus natalensis: 107542669
Entry
107542669         CDS       T05883                                 

Gene name
TAP1
Definition
(RefSeq) antigen peptide transporter 1 isoform X1
  KO
K05653  ATP-binding cassette, subfamily B (MDR/TAP), member 2
Organism
mna  Miniopterus natalensis
Pathway
mna02010  ABC transporters
mna04145  Phagosome
mna04612  Antigen processing and presentation
mna05163  Human cytomegalovirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107542669 (TAP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107542669 (TAP1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107542669 (TAP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107542669 (TAP1)
   05168 Herpes simplex virus 1 infection
    107542669 (TAP1)
   05163 Human cytomegalovirus infection
    107542669 (TAP1)
   05169 Epstein-Barr virus infection
    107542669 (TAP1)
  09163 Immune disease
   05340 Primary immunodeficiency
    107542669 (TAP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mna02000]
    107542669 (TAP1)
Transporters [BR:mna02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    107542669 (TAP1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran AAA_16 SMC_N AAA_22 ABC_ATPase AAA_21 AAA_29 AAA_23 AAA_15 AAA_25 AAA_30 SRP54 AAA_18 APS_kinase AAA_33 Zeta_toxin
Other DBs
NCBI-GeneID: 107542669
NCBI-ProteinID: XP_016075584
LinkDB
Position
Unknown
AA seq 549 aa
MAIPFFTGRLTDWILQDGTATAFTANITLMSILTIASAVLEFLGDGVYNSTMGRVHSRLQ
GEVFRAVLRQETEFFQQNQTGAITSRVTEDTSTLSESLSEKLSLLLWYLVRGLCLLGLML
WGSLSLTLVTLVALPLLFLLPKKLGKRYQALAAQVQESLAKSSQVAIEALSAIPTVRSFA
NEEGEAQKFRQKQQEMKTLNQKEALAYAVNLWTTSISGMLLKVGILYIGGQLVTSGAVSS
GNLVTFVLYQIQFTAAVEVLLSTYPNVQKAVGSSEKIFEYLDRIPCCPASGVLTPSNLEG
LVQFQDVSFAYPNHPDVPVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGK
LLLDGEPLPQYEHRYLHRQIAAVGQEPQLFGRSFRENIAYGLIQKPTLEEITAAAVESGA
HSFISELPQGYDTEVGEAGSQLSGGQRQAVALARALIRKPRVLILDDATSALDANSQLRV
ERLLYESPGRCSRSVLLITQCLSSVEQADHILFLEGGTISEAGTHQQLMENRGRYWAMVQ
APDGLGAPE
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggccattccattcttcaccggccgcctcactgactggattctacaagatgggacggcc
actgccttcacggcgaacataaccctcatgtccattctcaccatagccagtgcagtgctg
gagttcctgggcgatggggtctacaacagcaccatgggccgcgtgcacagccgcctgcag
ggcgaggtgtttcgggctgtcctgcgccaggaaacagagtttttccaacagaaccaaaca
ggtgccatcacatctcgggtaacagaggacacgtccaccctgagtgagtctctgagtgag
aagctgagcctgttgctgtggtacctggtgcgggggctgtgtctcttggggctcatgctc
tgggggtcactgtccctcaccctggtcactctggtcgccctgcctctgcttttccttctg
cctaagaagcttggaaaacggtaccaggcgctagcagcacaggtgcaggaatctctggcg
aagtccagccaggtggccattgaggctttgtcagccattcctacggtccggagctttgcc
aatgaggagggcgaggcccagaagttcaggcaaaaacagcaggaaatgaagacactcaac
cagaaagaggccctggcctatgcagtcaacctctggaccaccagcatctcagggatgctg
ctgaaggtgggaatcctatatatcggtgggcagctggtaacaagtggggctgtgagcagt
gggaacctcgtcacatttgtcctctaccagatccagttcaccgcagctgttgaggtactg
ctctccacctaccccaatgtgcagaaggctgtgggctcctcagagaaaatatttgagtat
ctggaccggatcccttgctgcccagccagtggtgtgttgactccttcgaacttggagggc
cttgttcagttccaagacgtctccttcgcctaccccaaccacccagatgtcccagtgctg
caggggctgacgttcaccctgcggcccggcgaggtgacggcgctggtggggcccaacggg
tccgggaagagcacggtggcggccctgctgcagaatctgtaccagcccacaggggggaag
ctgctgctggatggggagccccttccccagtatgagcaccgctacctgcaccggcagata
gctgcagtgggacaagagccacagctgtttggaagaagtttccgagaaaatattgcctat
ggcctgatccagaagccaactctggaggagatcacagctgctgcagtggagtctggagcc
catagtttcatctctgaactcccgcagggctatgacacagaggtaggtgaagctgggagc
cagctatcagggggtcagcgacaggcagtggccttggctcgagcgctgatccggaaacca
cgtgtactcatcctggacgatgctaccagtgccctggatgcaaacagccagttacgggtg
gagcgtctcctgtatgagagccccgggcgctgctctcggtctgtgctgctcatcacccag
tgtctcagctccgtggagcaggctgaccacatcctctttctggaaggaggcaccatctct
gaggcggggacccaccagcagctcatggagaacaggggacgctactgggctatggtgcag
gctcctgatgggctgggtgccccggaatga

DBGET integrated database retrieval system