KEGG   Miniopterus natalensis: 107542744
Entry
107542744         CDS       T05883                                 

Definition
(RefSeq) cytochrome P450 11B1, mitochondrial-like isoform X1
  KO
K00497  steroid 11beta-monooxygenase [EC:1.14.15.4]
Organism
mna  Miniopterus natalensis
Pathway
mna00140  Steroid hormone biosynthesis
mna01100  Metabolic pathways
mna04927  Cortisol synthesis and secretion
mna04934  Cushing syndrome
Module
mna_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    107542744
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107542744
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107542744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mna00199]
    107542744
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.4  steroid 11beta-monooxygenase
     107542744
Cytochrome P450 [BR:mna00199]
 Cytochrome P450, animal type
  CYP11 family
   107542744
SSDB
Motif
Pfam: p450 Baculo_p74
Other DBs
NCBI-GeneID: 107542744
NCBI-ProteinID: XP_016075671
LinkDB
Position
Unknown
AA seq 463 aa
MAFRARAEVWMAGSQLSLPWARALATHTPPAPKAVLPFEAIPQCPGNKWLRVLRIWREGS
EDFHLQMQQTFEELGPIFRYDVGGKHMVCVALPEDVDKLKQAEGYQPRRMVLEPWLAHRQ
HRGHKHGVFLLNGPAWRLDRLRLNPDVMSRQAVQKFIPMVDRVARDFSKALMANVLQNAR
RSLTVNIQPSIFYYTLEASNLVLFGERLGLLSQSPSAASLNFIHALEAMLKSTMQLMFMP
RSLSRWTSAKVWKEHFEAWDCIFQYANNSIQKIYQELALGRPQHYSGIVAELLLHADMTL
DAIKASSIDLTAGSVDTTAYPLLMTLFELARNPEVQQALRQESLLAEAKISENPQRATSE
LPLLQAALKETLRLYPVGISVDRQVSSDLVLQNYHIPAGTLVTVQLYYLGRNPSVFPRPE
LYHPQRWLHRGSSARLPHLAFGFGPRQCLGRRLAEAEMXXXLS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcattccgggccagggcagaagtgtggatggcaggatcccagctctccctgccctgg
gcgcgagcactggccacccacacccctccagctcccaaggcagtgctccccttcgaagcc
atcccccagtgtcctggcaacaagtggctgagggtgctgcggatctggagggagggttct
gaggacttccacctgcagatgcaacagaccttcgaggagctggggcccattttcaggtat
gacgtgggagggaaacacatggtgtgcgtggcgctgcccgaggacgtggataagctgaag
caggcagaaggctatcaaccccgtcggatggtcctggagccctggctggcccaccgacag
catcgcgggcacaaacatggcgtgttcttgctaaacgggcccgcatggcgcttggaccgc
ctgaggctgaacccagacgtgatgtcgcgacaggcagtccagaaattcatccccatggtg
gatagggtggcgagggatttctccaaggccctgatggccaatgtgctgcagaacgcccgg
aggagtctgaccgtgaacatccagcccagcatcttctactacaccctggaagccagcaat
ttggtcctttttggagagcggttgggcctccttagccaaagcccaagtgcagccagcctg
aacttcatccacgccctggaggccatgctgaaatccaccatgcagcttatgttcatgccc
aggagcctgtcccgctggacaagcgccaaggtgtggaaggagcactttgaggcctgggac
tgcatcttccagtatgccaacaactccatccagaaaatctaccaagaactggcccttggc
cgcccacagcactacagtggcatcgtggcagagctgctcctgcatgcagacatgaccctg
gatgccatcaaggctagctccatcgacctcactgcggggagcgtggacacgacagcctac
cccttgctgatgaccctctttgagctggcacgtaaccctgaggtgcagcaggccctgcgt
caggagagcctgctggccgaggccaagatctctgaaaatccccagagagcaacctcagaa
ctgcccctgctacaggctgccctcaaggagaccctgaggctgtaccccgtgggcatctct
gtggatcggcaggtgagctcggacttggtcctgcagaactaccacatcccggctgggaca
ttggtcactgtgcaactctactacctgggtcgcaacccctcggtgtttccacggcccgag
ctctaccatccgcaacgctggctgcacaggggctccagcgccaggctgccccacctggcc
tttggctttggcccccggcagtgcctggggcggcgcctggcggaggccgagatgnnnnnn
nctctgtcctag

DBGET integrated database retrieval system