KEGG   Miniopterus natalensis: 107542784
Entry
107542784         CDS       T05883                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04062  Chemokine signaling pathway
mna04611  Platelet activation
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107542784 (RASGRP2)
   04014 Ras signaling pathway
    107542784 (RASGRP2)
   04015 Rap1 signaling pathway
    107542784 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107542784 (RASGRP2)
   04062 Chemokine signaling pathway
    107542784 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107542784 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mna04990]
    107542784 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:mna04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107542784 (RASGRP2)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 107542784
NCBI-ProteinID: XP_016075720
LinkDB
Position
Unknown
AA seq 650 aa
MRTGIAGGVVQALSSPHGNGAPFWAPYSLCPRVAGQFVRSRFNCAALDLDKGCTVEELLR
GCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSQKDNSSSLQLKTCHL
VRYWISAFPAEFDLNHELAEQIKELKALLDQEGNRRHSSLIDIESVPTYKWKRQVTQRNP
VEQKKRKMSLLFDHLEPLELAEHLTYLEYRSFRKILFQDYHSFVTHGCTVDNPVLERFIS
LFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRL
KETHSHVSPETIKLWEGLTELVTATGNYSNYRRRLAACVGFRFPILGVHLKDLVALQLAL
PDWLDPARTRLNGAKMKQLFSILEELAMVNSLQPPVQANPDLLSLLTVSLDQYQTEDELY
QLSLQREPRCKSSPTSPTSCTPPPRAPVLEEWTSAAKPKLDQALMVEHIEKMVESVFRNF
DVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMISYFLRSSSVLGGRMGFV
HNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLD
GCVPSPSPTHTHHRAFSFSLPRPGRRGSRPPGIREEQAQPVDDAVFDIHL
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgcgtactggaattgctggtggtgtcgtccaggcactctccagcccccacggcaatggc
gcccccttctgggcaccctactctttgtgtccgcgtgtggccggccagttcgtgcgctca
cggttcaactgtgcagccctggacctggacaagggctgcacggtggaggagctgctccgc
ggctgcatcgaagccttcgatgactccgggaaggtgcgggacccgcagctggtgcgcatg
ttcctcatgatgcacccctggtacatcccttcatctcagctggcggcaaaactgctccac
atctaccaacaatcccagaaggacaactccagttcactgcagttgaaaacttgtcatcta
gtccggtactggatctcagcattcccggcagagtttgacttgaaccacgagcttgctgag
cagatcaaggagttgaaggctctgctggaccaagaagggaaccgcaggcatagcagcctc
atcgacatcgagagcgtccccacctacaagtggaagcggcaggtgactcagcggaaccca
gtggaacagaaaaaacgaaagatgtccctgttgttcgaccacctggagcctctggagctg
gctgagcatctcacctacctggagtatcgctccttccgcaagatcctgttccaggactat
cacagctttgtgactcacggctgcaccgtggacaaccctgtcctggagcgattcatttcc
cttttcaacagtgtctcgcagtgggtgcagctcatgattctcagcaagcccacagcccca
cagcgggccctggtcatcacacacttcgtccacgtggcagagaagctgctgcagctgcag
aacttcaacacgctgatggcggtggtcgggggcctgagccacagctccatctctcgcctc
aaggagacccacagccacgttagccctgagaccatcaagctctgggaaggtctgacagaa
ctagtgacggccactggcaactatagcaactaccgacggcggctggcagcctgtgtgggc
ttccgcttccccatcctgggtgtgcacctcaaggacctggtggccctgcagctggccctg
cctgactggctggaccctgcccggacccgacttaatggggccaagatgaagcagctcttc
agcatcttggaggagctggccatggtgaacagccttcagccaccagtgcaggctaacccc
gacctgctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctctac
cagctgtccctgcagcgggagccgcgctgcaagtcctcgccaaccagccccacaagctgc
acgcctcctccccgcgccccagtgctggaggaatggacctcagctgccaaacccaagctg
gatcaggcactcatggtggagcacattgagaagatggtggagtctgtgttccggaacttt
gacgtcgatggggacggccacatctcacaggaagagttccagatcatccgtgggaacttt
ccttacctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggag
gagatgatctcctacttcctccgctccagctctgtgctgggcggccgcatgggcttcgta
cacaacttccaggagagcaactccttgcgcccggttgcctgccgccactgcaaggccctg
atcctgggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaag
cagtgcaaagatcgcttgtcagtggagtgccggcgccgggcccagagtgtgagtctggat
gggtgtgtgccctcaccttcacccacacacacccaccatcgagccttcagcttctctctg
cccagaccaggcaggcgaggctcccggcctccagggatccgagaagagcaggcccagccg
gtggatgacgcagtgtttgacatccacctctaa

DBGET integrated database retrieval system