KEGG   Miniopterus natalensis: 107543176
Entry
107543176         CDS       T05883                                 

Gene name
CLCA1
Definition
(RefSeq) calcium-activated chloride channel regulator 1
  KO
K05027  calcium-activated chloride channel regulator 1
Organism
mna  Miniopterus natalensis
Pathway
mna04924  Renin secretion
mna04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107543176 (CLCA1)
  09154 Digestive system
   04972 Pancreatic secretion
    107543176 (CLCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543176 (CLCA1)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107543176 (CLCA1)
SSDB
Motif
Pfam: CLCA VWA_2 VWA VWA_CoxE
Other DBs
NCBI-GeneID: 107543176
NCBI-ProteinID: XP_016076108
LinkDB
Position
Unknown
AA seq 914 aa
MGSFKSSVFILVFHLLEGALSNSLIQLNGNGYEGIVIAIDPNVPEDETLIQEIKDMVTQA
SPYLFEATEKRFYFKSVAILIPEKWKTKPEYVRPKLETYKNADVLVAEPNPPDNDEPYTE
QMGNCGEKGERIHFTPNFIAGKMLTQYGPQGRAFVHEWAHLRWGVFDEYNKDQKFYLSNG
KNKAISCSAAITGKNVIRKCQGGSCFTKTCRIDRLTGLFEKGCEFIPDDRHTEKASIMFS
QSINSVVEFCTEKNHNKEAPNLQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPKPTFSLL
QVGQRIVCLVLDKSGSMQNGNRLKRMNQAGKLFLLQTVEQGAWVGMVTFDSAAYVQSELI
QINSGAERDALIGKLPTKAGGGTSICTGLQSAFTMIRKKYPTDGSEIVLLTDGEDTKIST
CFDAVKQSGAVIHTVALGPDAAKELEELSKMTGGLQTYASDKAQNNGLIDAFGALSSGNG
AISQRSIQLESTGLTLQTSEWMNGTVIVDSTVGNDTLFLITWTVQPPQILLWDPSGKKQD
GFLVDTDTKMAYLPVPGTAKVGIWNYSLQANSAQTLTLTVTTRASHATLPPVTVTSKMNK
DTGKFPSPMAVYAKVHQGALPILRASVTALIESADGKTVTLELLDNGAGADAAKDDGIYS
RYFTAYDTNGRYSLKVRALGGVNAARRRAAPPQNAALYIPGWTENGEVKWNPPRPDISED
HLQGKQVCFSRTSLGGSFVASNVPKAPIPDLFPPCQITDLKAKIQGDSLINLTWTAPGDD
YDHGRAYRYIIGISTNILDLRDKFNESVLVNTTDLIPKEANSQEVFVFKPESITFENGTD
LFIAVRAVDKVNLTSEISNIARASLFIPPQTPPETPGPSLPCPDINVNSTIPGIHILKIM
WKWLGELQLSVALG
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggggtcgtttaagagctctgttttcatcttggtctttcaccttctggaaggggccctg
agcaattcactcattcagctgaatggtaatggctatgagggtattgtcattgcaattgac
cccaacgtgccagaagacgaaacactcattcaagaaataaaggacatggtgactcaggca
tctccatatctgtttgaagctacagaaaaacgattctatttcaaaagtgttgctattttg
attcctgagaaatggaagacaaaacctgagtatgtgagaccaaagctcgagacctacaaa
aatgctgatgttctggttgctgaacctaatcctccagataacgatgaaccctatactgag
cagatgggaaactgtggagaaaagggtgaaaggattcatttcactcctaacttcatcgca
ggaaaaatgttgactcaatatggaccacaaggaagggcatttgtccatgaatgggcccac
ctacgatggggagtatttgatgagtacaataaagaccagaaattctacttatctaatgga
aaaaacaaagcaataagttgttcggcagcgattactggtaaaaatgtcataaggaagtgt
caaggaggcagttgtttcaccaaaacctgcagaattgacaggctaacagggctgtttgaa
aaaggatgtgagttcatacctgatgacaggcatacagagaaggcttccatcatgttttca
caaagtattaattctgtggtggaattctgtacagagaaaaaccacaataaagaagcccca
aacctgcagaaccaaaaatgcaacctccgaagcacatgggaagtgattcgcgattctgag
gactttaaaaaaaccactcctatgacaacacagccccccaaacccaccttctcgctgctg
caggtcggacagagaatcgtgtgcttagttctggataagtctggaagcatgcagaacggt
aaccgcctcaaacgaatgaaccaggcaggcaaacttttcctgctgcagacggttgagcaa
ggggcctgggtcgggatggtgacctttgacagcgctgcctacgtccaaagtgaactcata
cagataaacagcggcgccgaaagggatgcgctcatcggaaagctcccgacaaaggccgga
ggaggaacgtccatctgcactggactgcaatcagcatttactatgattaggaagaaatac
ccaacagatggatctgaaattgtgctactaactgatggggaggacaccaagataagcacc
tgcttcgacgcggtgaaacagagcggagcagtcatccacacagttgctctggggcctgat
gctgcgaaagaactggaggagctgtctaaaatgacaggcggtttacagacatatgcttca
gataaggctcagaacaatggcctcattgacgcttttggggccctttcatcaggaaatggc
gccatctcccagcgctccatccagctggagagtacaggattaactctccagaccagtgag
tggatgaacggcacagtgatcgtggacagcactgtgggaaacgacactctgtttctcatc
acctggaccgtgcagcccccccagatccttctctgggatcccagcggaaagaagcaagac
ggctttctcgtggacacagacaccaagatggcctacctcccagtcccaggcactgccaag
gttggcatttggaattacagtctgcaagcaaactcagcgcagaccctgacattgactgtc
accacccgcgcctcacatgctaccttgcctccagttacagtgacctctaaaatgaacaaa
gacacaggcaaattccctagccctatggcagtttacgcaaaagttcaccaaggggccttg
ccgattctcagggccagtgtcacagccctgatagaatcagcggatggaaaaacagtcacc
ttggaacttttggacaatggagcaggtgctgatgctgctaaggacgacggtatctattcg
aggtattttacagcttacgacacaaatggcagatacagcctaaaagtgcgggctctgggc
ggagtgaacgcagcccggcggagagctgcgcccccgcagaatgcagccctgtacatacct
ggctggactgagaacggggaagtgaaatggaacccgccgaggcctgacattagcgaggat
cacctgcaaggcaagcaagtgtgtttcagcaggacatccttgggagggtcatttgtagcc
tccaatgtcccaaaggctcccatacctgacctctttccaccttgtcaaatcactgacctg
aaggcgaaaatccagggggacagtcttattaatctgacgtggacggcgcctggggacgac
tatgatcacggaagagcttacaggtatattatcggaataagcacaaatattcttgatctc
agagacaagttcaatgaatcggttctagtgaacactactgatctcattccaaaggaggcc
aactctcaggaagtctttgtgtttaaaccagaaagcatcacttttgaaaatggcacggat
ctcttcatagctgttcgggctgttgataaggtcaacctgacgtcggaaatctccaacatt
gcacgggcatctttgtttattcccccacagactcctcctgagacacctggcccttctctc
ccttgtcctgatattaatgtcaacagcactattcctggcattcacattttaaaaattatg
tggaagtggctaggagagttgcagctgtcagtagccttgggttga

DBGET integrated database retrieval system