KEGG   Miniopterus natalensis: 107543177
Entry
107543177         CDS       T05883                                 

Gene name
CLCA4
Definition
(RefSeq) calcium-activated chloride channel regulator 4
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
mna  Miniopterus natalensis
Pathway
mna04924  Renin secretion
mna04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107543177 (CLCA4)
  09154 Digestive system
   04972 Pancreatic secretion
    107543177 (CLCA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543177 (CLCA4)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107543177 (CLCA4)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_CoxE
Other DBs
NCBI-GeneID: 107543177
NCBI-ProteinID: XP_016076109
LinkDB
Position
Unknown
AA seq 922 aa
MVLFRSLAFLLVLYLLQGSNTSFVRLNNNGYEGIIIAIDPGVPEHATLIEQIKDMVTAAS
TYLFEATERRFFFKTVSILIPETWKENPQYKRPKHESYKHADILVAPPTLPGRDEPYTKQ
FTACEEKGEYIHFTPDFVLGKKQNEYGPAGRLLVHEWAHLRWGVFDEYNDNEPFYSAASK
RIEATRCSTGITGMNRVYKCQGNSCVYNRCKINSTTKLYEKGCQFFPDKDQIEKTSIMFM
QGITSVVGFCNENNHNREAPSLQNKMCHSRSTWEVISKSEDLKNTTPMVESPPSPVFSLL
RIRERIVCLVLDKSGSMGSFNRLSRMNQAAKHFLLQTIENGSWVGMVHFDSSASIKNKLI
QIVSTNERNTLLNSLPTAAGGGTSICSGIDAAFQVMRDVNAQISGSEIVLLTDGEDGTAK
VCVDKVKESGAIVHFIALGPSADQAVIQMSNITGGKHFFASDKAQNNGLIDAFGALASGN
ADISQQSLQLESKGSQLSNSLWMNGTVTIDSTVGKDTFFLITWEKQNPVIFLWDPSGASV
QNLVQDSVSKMAYVSIPGTAKVGDWTYSLQAKADAEILTVTVNSRAANSSVPPITVNAKM
NKETNSFPSPMIVYAEILQGFIPILGANVTAFIESNSGKTEVLELLDNGAGADTFKDDGV
YSRYFTAYSENGRYSLKVRAHGGANVATRNLRHPPNRAAYIPGWVVGGKIEGNPPRPEIN
EDIGTSLESFTRTASGGAFVVSNVSNLPLLDLYPPSQITDLEATPDGDLIHLTWTAPGDN
FDVGKVKQYIIRISENILDLRDKFDDALQVNTTHLLPNEANSRETFAFKPGNISEGNATH
IFIAIQSVDNSSLTSKVSNIAQVALFVPQDPDESHPNPNSGISISSLVLIVVGSVVIVSI
ILSATICILNKKKHSSRPSTGF
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggtattattcagaagccttgccttcctcctagtcctatacctgctgcaggggtccaat
acttcctttgttcggctgaataacaatggctatgaaggcattatcattgctatcgaccct
ggggtgccagaacatgcaacactgattgaacaaatcaaggacatggtgactgcagcttct
acttacctgtttgaagccacagaaagaagattttttttcaaaactgtatcaatattaatt
cctgagacttggaaggaaaaccctcaatacaagagaccaaaacatgaaagctacaaacat
gctgatattttagttgcaccacccaccctaccagggagagatgaaccatacaccaagcag
ttcacagcctgtgaagagaaaggagaatacattcatttcacccctgactttgtacttgga
aaaaaacaaaatgaatatgggccagcaggcagactgcttgtccacgagtgggcccatctc
cgctggggagtgtttgatgaatacaatgacaacgagcctttctacagtgctgcgtccaaa
agaattgaagcaacaaggtgttccacaggtattactggtatgaatagagtttataagtgt
caaggaaacagctgtgtatataatagatgcaaaattaattctacaacaaagctgtacgaa
aaaggttgccagttcttccctgataaagatcaaattgaaaagacatccataatgtttatg
caaggtattacttctgttgttggattctgtaatgaaaacaaccataaccgagaagctcca
agcctacagaacaaaatgtgccattccagaagcacgtgggaggtgatcagcaaatctgag
gatttaaagaacaccacacctatggtggaatcacctccttcacctgtcttctcattgctg
aggatcagagaaagaattgtgtgcttagttcttgataagtctggaagcatggggagcttt
aatcgcctaagtcgaatgaaccaagcagcaaaacacttcctgctgcagactattgaaaac
ggatcctgggtggggatggtgcactttgattcttctgccagcattaaaaataagctaatc
caaatagtaagcaccaacgaaagaaacacactcttgaacagcttgcctacggcagcaggc
gggggaacgtccatctgcagtggaattgatgcagcatttcaggtaatgagagatgtaaat
gcccagataagtggatctgaaatagtgctgctgaccgatggggaggatggtactgcaaaa
gtatgtgttgataaagtgaaagaaagtggggccatcgttcattttattgctttgggacca
tcggctgatcaagcagtcatacagatgagcaatataacaggaggaaaacatttttttgcc
tcggataaagcccagaacaacggcctcattgacgcgtttggggcccttgcatcaggaaac
gccgatatctcccagcagtctcttcagcttgaaagtaagggatcacagctcagtaatagt
ctctggatgaatggaactgtaacaatcgatagcactgtgggaaaggacacattcttcctc
atcacgtgggaaaaacagaaccccgtgatttttctctgggatcccagtggagcatcagta
caaaatttggtacaggactctgtttccaaaatggcctatgtcagcattccaggaactgca
aaggtgggtgattggacttacagtcttcaagccaaagcagacgcagaaatcttaactgta
acagttaattctcgggcagcaaattcttctgtgcctccaatcacagtgaatgctaaaatg
aacaaagaaaccaacagcttccccagcccaatgattgtttacgcagaaattctacaaggg
tttatacccattcttggagccaacgtgactgcgttcattgaatcaaatagtggaaaaaca
gaagttttggaacttttggataatggtgcaggtgctgatactttcaaggatgatggtgtc
tactccagatattttacagcttattcagaaaatggcagatacagcttaaaagtgcgggct
catggaggagcgaacgttgccacaagaaacttgaggcacccaccgaatagagctgcatac
attccaggctgggtggtgggcgggaaaattgaagggaacccaccaagacctgaaattaat
gaagatattgggacatccttggagagtttcaccaggacagcatctggaggtgcatttgtg
gtttcaaatgtttcaaacttacccttgcttgacctgtacccaccaagtcaaatcacagat
cttgaggccacaccagacggggatctgatccatctaacatggacagcaccaggagacaat
tttgatgttggaaaagttaaacagtatatcataagaataagtgaaaatatactggatcta
agagacaagtttgatgatgctctgcaagtaaacactactcatctgttaccaaatgaggcc
aactccagggaaacctttgcatttaaaccaggaaatatctcagaaggaaacgcaacccac
atattcattgccattcaaagtgtggataacagcagtttgacatcaaaagtatccaacatt
gcacaagtagctttgtttgttcctcaagatcctgatgaaagtcatccaaatcctaattct
ggaattagcatttcttctttggtgttgatagtagttggatctgtggtcattgttagtatt
attttaagtgccaccatttgtatcttaaacaagaaaaaacattcaagcagacccagtaca
gggttctaa

DBGET integrated database retrieval system