KEGG   Miniopterus natalensis: 107543188
Entry
107543188         CDS       T05883                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04114  Oocyte meiosis
mna04140  Autophagy - animal
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04340  Hedgehog signaling pathway
mna04371  Apelin signaling pathway
mna04530  Tight junction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04910  Insulin signaling pathway
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04976  Bile secretion
mna05012  Parkinson disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107543188 (PRKACB)
   04014 Ras signaling pathway
    107543188 (PRKACB)
   04310 Wnt signaling pathway
    107543188 (PRKACB)
   04340 Hedgehog signaling pathway
    107543188 (PRKACB)
   04371 Apelin signaling pathway
    107543188 (PRKACB)
   04020 Calcium signaling pathway
    107543188 (PRKACB)
   04024 cAMP signaling pathway
    107543188 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107543188 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107543188 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107543188 (PRKACB)
   04540 Gap junction
    107543188 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107543188 (PRKACB)
   04062 Chemokine signaling pathway
    107543188 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    107543188 (PRKACB)
   04910 Insulin signaling pathway
    107543188 (PRKACB)
   04922 Glucagon signaling pathway
    107543188 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    107543188 (PRKACB)
   04912 GnRH signaling pathway
    107543188 (PRKACB)
   04913 Ovarian steroidogenesis
    107543188 (PRKACB)
   04915 Estrogen signaling pathway
    107543188 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    107543188 (PRKACB)
   04921 Oxytocin signaling pathway
    107543188 (PRKACB)
   04926 Relaxin signaling pathway
    107543188 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    107543188 (PRKACB)
   04918 Thyroid hormone synthesis
    107543188 (PRKACB)
   04919 Thyroid hormone signaling pathway
    107543188 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    107543188 (PRKACB)
   04916 Melanogenesis
    107543188 (PRKACB)
   04924 Renin secretion
    107543188 (PRKACB)
   04925 Aldosterone synthesis and secretion
    107543188 (PRKACB)
   04927 Cortisol synthesis and secretion
    107543188 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107543188 (PRKACB)
   04270 Vascular smooth muscle contraction
    107543188 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    107543188 (PRKACB)
   04971 Gastric acid secretion
    107543188 (PRKACB)
   04976 Bile secretion
    107543188 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107543188 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107543188 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107543188 (PRKACB)
   04727 GABAergic synapse
    107543188 (PRKACB)
   04725 Cholinergic synapse
    107543188 (PRKACB)
   04728 Dopaminergic synapse
    107543188 (PRKACB)
   04726 Serotonergic synapse
    107543188 (PRKACB)
   04720 Long-term potentiation
    107543188 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    107543188 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    107543188 (PRKACB)
   04742 Taste transduction
    107543188 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    107543188 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    107543188 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    107543188 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107543188 (PRKACB)
   04714 Thermogenesis
    107543188 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543188 (PRKACB)
   05205 Proteoglycans in cancer
    107543188 (PRKACB)
   05203 Viral carcinogenesis
    107543188 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107543188 (PRKACB)
   05020 Prion disease
    107543188 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    107543188 (PRKACB)
   05031 Amphetamine addiction
    107543188 (PRKACB)
   05032 Morphine addiction
    107543188 (PRKACB)
   05034 Alcoholism
    107543188 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107543188 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107543188 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107543188 (PRKACB)
   05163 Human cytomegalovirus infection
    107543188 (PRKACB)
   05165 Human papillomavirus infection
    107543188 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107543188 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107543188 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107543188 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107543188 (PRKACB)
   03036 Chromosome and associated proteins [BR:mna03036]
    107543188 (PRKACB)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107543188 (PRKACB)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKA family
   107543188 (PRKACB)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107543188 (PRKACB)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107543188 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107543188
NCBI-ProteinID: XP_016076130
LinkDB
Position
Unknown
AA seq 397 aa
MAAYRDLSGNQYTGTTALQKLEGFASRLFHRHSKGAAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCGKEFSEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttatagagacctctccggtaaccagtatacaggtacaactgctctccagaaa
ttggaaggttttgctagccggttatttcatagacactctaaaggtgctgcacatgatcag
aaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttttaaaaaagtgggaaaatcct
gctcagaataatgccggcctggaggattttgaaaggaaaaaaacccttggaacaggttcc
tttggaagagtcatgttggtgaaacacaaagccacagagcagtattacgccatgaagatc
ttagataagcagaaggttgttaaactgaagcagatagagcatactttgaatgagaaaaga
atattgcaggcagtgaatttcccttttcttgttcgactggagtattcttttaaggataat
tctaatttatatatggttatggaatatgtccctggaggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccactcactagacctcatctacagagatctgaaacctgaaaatctctta
attgaccaccaaggttatatccaggtcacagactttggatttgccaaaagagttaaaggc
agaacttggacattgtgtggcactccagaatatctggctccagaaataatcctcagcaag
ggctacaataaggcagtggactggtgggcattgggggtgctaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggttcgattcccgtcgcacttcagttccgacctcaaggaccttctgcggaacctgctg
caggtggatttgacaaagcggtttggaaatctgaagaacggtgtgagcgatataaagact
cacaagtggtttgccacaacagattggattgctatttaccagaggaaggttgaagctcca
ttcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaggaa
gatatccgtgtctctataacagaaaagtgtgggaaggaatttagtgaattttaa

KEGG   Miniopterus natalensis: 107544336
Entry
107544336         CDS       T05883                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04062  Chemokine signaling pathway
mna04114  Oocyte meiosis
mna04140  Autophagy - animal
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04310  Wnt signaling pathway
mna04340  Hedgehog signaling pathway
mna04371  Apelin signaling pathway
mna04530  Tight junction
mna04540  Gap junction
mna04611  Platelet activation
mna04713  Circadian entrainment
mna04714  Thermogenesis
mna04720  Long-term potentiation
mna04723  Retrograde endocannabinoid signaling
mna04724  Glutamatergic synapse
mna04725  Cholinergic synapse
mna04726  Serotonergic synapse
mna04727  GABAergic synapse
mna04728  Dopaminergic synapse
mna04740  Olfactory transduction
mna04742  Taste transduction
mna04750  Inflammatory mediator regulation of TRP channels
mna04910  Insulin signaling pathway
mna04911  Insulin secretion
mna04912  GnRH signaling pathway
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04915  Estrogen signaling pathway
mna04916  Melanogenesis
mna04918  Thyroid hormone synthesis
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04922  Glucagon signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04926  Relaxin signaling pathway
mna04927  Cortisol synthesis and secretion
mna04928  Parathyroid hormone synthesis, secretion and action
mna04934  Cushing syndrome
mna04935  Growth hormone synthesis, secretion and action
mna04961  Endocrine and other factor-regulated calcium reabsorption
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
mna04971  Gastric acid secretion
mna04976  Bile secretion
mna05012  Parkinson disease
mna05020  Prion disease
mna05030  Cocaine addiction
mna05031  Amphetamine addiction
mna05032  Morphine addiction
mna05034  Alcoholism
mna05146  Amoebiasis
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107544336 (PRKACA)
   04014 Ras signaling pathway
    107544336 (PRKACA)
   04310 Wnt signaling pathway
    107544336 (PRKACA)
   04340 Hedgehog signaling pathway
    107544336 (PRKACA)
   04371 Apelin signaling pathway
    107544336 (PRKACA)
   04020 Calcium signaling pathway
    107544336 (PRKACA)
   04024 cAMP signaling pathway
    107544336 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107544336 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107544336 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107544336 (PRKACA)
   04540 Gap junction
    107544336 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107544336 (PRKACA)
   04062 Chemokine signaling pathway
    107544336 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    107544336 (PRKACA)
   04910 Insulin signaling pathway
    107544336 (PRKACA)
   04922 Glucagon signaling pathway
    107544336 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    107544336 (PRKACA)
   04912 GnRH signaling pathway
    107544336 (PRKACA)
   04913 Ovarian steroidogenesis
    107544336 (PRKACA)
   04915 Estrogen signaling pathway
    107544336 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    107544336 (PRKACA)
   04921 Oxytocin signaling pathway
    107544336 (PRKACA)
   04926 Relaxin signaling pathway
    107544336 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    107544336 (PRKACA)
   04918 Thyroid hormone synthesis
    107544336 (PRKACA)
   04919 Thyroid hormone signaling pathway
    107544336 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    107544336 (PRKACA)
   04916 Melanogenesis
    107544336 (PRKACA)
   04924 Renin secretion
    107544336 (PRKACA)
   04925 Aldosterone synthesis and secretion
    107544336 (PRKACA)
   04927 Cortisol synthesis and secretion
    107544336 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544336 (PRKACA)
   04270 Vascular smooth muscle contraction
    107544336 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    107544336 (PRKACA)
   04971 Gastric acid secretion
    107544336 (PRKACA)
   04976 Bile secretion
    107544336 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544336 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107544336 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107544336 (PRKACA)
   04727 GABAergic synapse
    107544336 (PRKACA)
   04725 Cholinergic synapse
    107544336 (PRKACA)
   04728 Dopaminergic synapse
    107544336 (PRKACA)
   04726 Serotonergic synapse
    107544336 (PRKACA)
   04720 Long-term potentiation
    107544336 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    107544336 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    107544336 (PRKACA)
   04742 Taste transduction
    107544336 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    107544336 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    107544336 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    107544336 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107544336 (PRKACA)
   04714 Thermogenesis
    107544336 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544336 (PRKACA)
   05205 Proteoglycans in cancer
    107544336 (PRKACA)
   05203 Viral carcinogenesis
    107544336 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107544336 (PRKACA)
   05020 Prion disease
    107544336 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    107544336 (PRKACA)
   05031 Amphetamine addiction
    107544336 (PRKACA)
   05032 Morphine addiction
    107544336 (PRKACA)
   05034 Alcoholism
    107544336 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107544336 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107544336 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544336 (PRKACA)
   05163 Human cytomegalovirus infection
    107544336 (PRKACA)
   05165 Human papillomavirus infection
    107544336 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107544336 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107544336 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107544336 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mna03019]
    107544336 (PRKACA)
   03036 Chromosome and associated proteins [BR:mna03036]
    107544336 (PRKACA)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107544336 (PRKACA)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: AGC group
  PKA family
   107544336 (PRKACA)
Messenger RNA biogenesis [BR:mna03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107544336 (PRKACA)
Chromosome and associated proteins [BR:mna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107544336 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107544336
NCBI-ProteinID: XP_016077690
LinkDB
Position
Unknown
AA seq 343 aa
MASNFNDVKEFLAKAKEDFLKKWENPAQNTANLDQFERIKTLGTGSFGRVMLVKHKETGN
HFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMIMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSISEKCGKEFSEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcttccaacttcaacgatgtgaaagagttcttagccaaagccaaagaagattttctt
aaaaaatgggaaaatcctgctcagaatacggccaatttggatcagtttgaacgaatcaag
accctcggcacgggctcctttgggcgagtgatgctggtgaaacacaaggagaccgggaac
cactttgccatgaagatcctggacaaacaaaaggtggtgaagctgaaacagatcgagcac
accctgaatgagaagcgcatcctgcaggctgtcaactttccgttccttgtcagacttgaa
ttctccttcaaggacaactcaaatttatacatgatcatggagtatgtgcctggcggggaa
atgttctcacacctgcggcggatcgggaggttcagcgagccccatgcccgcttctacgct
gcacagatcgtcctgaccttcgagtacctgcactcgcttgatctcatctaccgggaccta
aagccggagaaccttctcatcgaccagcagggctacattcaggtgacagactttggtttt
gccaagcgtgtgaaaggccgcacctggactttgtgcgggacccccgagtacctggctcct
gagattatcctgagcaaaggctacaacaaggctgtggactggtgggccctgggggttctc
atctacgagatggctgctggctacccacccttctttgctgaccagcctattcagatctat
gagaagattgtttctgggaaggtgcggttcccatcccacttcagctctgacctgaaggat
ctgctgcggaacctcctgcaggtggaccttaccaagcgcttcgggaacctcaagaatgga
gtcaatgacattaagaaccacaagtggtttgccacgactgactggattgccatctaccag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaacttt
gatgactatgaagaggaagagatccgagtctccatcagtgagaagtgtggcaaggagttt
tctgagttttag

DBGET integrated database retrieval system