KEGG   Miniopterus natalensis: 107543189
Entry
107543189         CDS       T05883                                 

Gene name
CLCA2
Definition
(RefSeq) calcium-activated chloride channel regulator 2
  KO
K05028  calcium-activated chloride channel regulator 2
Organism
mna  Miniopterus natalensis
Pathway
mna04924  Renin secretion
mna04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107543189 (CLCA2)
  09154 Digestive system
   04972 Pancreatic secretion
    107543189 (CLCA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543189 (CLCA2)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107543189 (CLCA2)
SSDB
Motif
Pfam: CLCA VWA VWA_2
Other DBs
NCBI-GeneID: 107543189
NCBI-ProteinID: XP_016076132
LinkDB
Position
Unknown
AA seq 943 aa
MSRRDNAGTVCSLKIVTLLVALSPELLFLGAGVQLQDNGYDGLLIAINPQVPEDQNLIPN
IKEMMTEASFYLFNATKRRVSFRNIKILIPATWKANNYSKVKQESYEKANVIVTDWHGAH
GGDPYTLQHRGCGKEGKHIYFTPDFLLNEDLIAGYGSRGRVFVHEWAHLRWGVFDEYNNE
KPFYINGQNQIKVTRCSSDITGMFVCEKGPCPQENCIISKLFQEGCTFIYNSTQNATASI
MFMQSLSSVVEFCNASTHNQEAPNLHNQLCSLRSTWDVISGSADFRGSSPVSGAELPPPP
TFSLLQPGAKVVCLVLDVSSNMAEADRLLRLQQAAEFYLMQIVEIHTFVGIVSFNSKGEI
RAQLQQVNDDDDRKLLASYLPATVSAEAETSICSGLKRGFEVAEKLNGKAYGSVMILVTS
GNDGHFSNCLLTVLSSGSTVHTIALGSSADKNLEEFSHLTGGLKFFVPDKSNSNSMIDAF
GRISSGTGDVFQQRVQLESMGGNVKPHRQLKSTVAVDNGVGNDTAFLVAWQTSGPPEIVL
WDPSGRQYHTHNFTVNQALRTARLWIPGTAKPGLWTYMLNNTHHSLQALKVTVTSRASRS
AQPPATVEAFVEKDSTSFPHPMVIYANVRKGFNPILNATVTATIEPETEDPVTLKLFDNG
AGADVIKNDGIYSRYFFSFAVNGRYSLKVHINHSPSISALGHSIPGSHAMYVPGYITNGN
IQMNAARRSMGRSEEEQKGGFSRISSGGSFSVLGVPAGPHPDVFPPCQIIDLAAVKVDEE
VTLSWTAPGEDFDQGQANSYEIRMSKSLQDIRDDFNNAILVNTTKLNPQQAGTKEIFTFS
PKLFISGPEHQPDGETQESHRIYVAIRTIDKNSLKSAVSNVAQASLFIPPNSAPVLTRDD
LILKGVLTAMGLIGIICLTITVTHYILNKKKRADRKENGTKLL
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgagccgcagggacaatgcaggtactgtttgcagcctgaagattgtgactctcctggtg
gccctaagtccagagctcctattcctgggagctggagtgcagcttcaagacaacgggtat
gatggactactcattgcaatcaatcctcaggtacccgaggatcagaacctcatcccaaac
attaaggaaatgatgactgaagcttctttttacctattcaatgctaccaagagaagagtg
tctttcagaaacataaagattttaatacctgccacatggaaagctaataattacagcaaa
gttaaacaagaatcatatgaaaaggcaaatgttatagtgactgactggcatggggcacat
ggaggtgatccatataccttacaacatagagggtgtggaaaagagggaaaacacatttat
ttcacacctgactttctactaaatgaagacttaatagctggctatggatcacgaggcaga
gtgtttgtccacgaatgggcccatctccgttggggtgtgtttgatgaatataacaatgag
aaacctttctacataaatgggcaaaatcaaattaaagtaacaaggtgttcatctgacatc
acaggcatgtttgtgtgtgaaaaaggcccttgcccccaagagaactgtattattagtaag
ctcttccaagaaggatgcacgtttatatataatagcactcaaaatgcaacagcatcaata
atgttcatgcaaagtttatcctctgtggttgaattctgtaatgcaagtacccacaaccaa
gaagcgccaaacctgcacaaccaactgtgcagcctcagaagcacgtgggatgtgatctca
ggctccgcggactttcgtggcagctcccccgtgagcggggctgagctgccgccccctccc
acgttctccctcctccagcctggggccaaggtggtctgcttagtgctggatgtgtccagc
aacatggcagaggctgacagactccttcgactgcagcaagcagcagaattttacttgatg
cagattgtggaaattcatacctttgtgggcattgtcagtttcaacagcaaaggagagatc
agagcccagctgcagcaagttaacgatgatgacgaccgaaagttgctggcttcatatctg
cctgccactgtgtcagctgaagcagaaaccagcatctgctcagggcttaagaggggattt
gaggtggctgaaaaactgaatggaaaagcctatggctctgtgatgatattagtgaccagt
ggaaatgatgggcacttcagcaactgcttactcacggtgctcagcagtggttcaaccgtt
cacaccattgccctgggctcatccgctgacaaaaacctggaagaattctcacatcttaca
ggaggtttgaagttctttgttccagataaatcaaactccaacagcatgattgatgctttc
gggagaatttcctctggaaccggagatgtttttcaacaacgtgttcagcttgaaagcatg
ggagggaatgttaaacctcaccgccagctgaaaagcactgtggctgtggataacggtgtg
ggcaatgacaccgcctttctggtcgcatggcagaccagcggtccccctgagattgtactg
tgggatcctagcggaagacaataccacacacataattttaccgtcaatcaagctctgagg
actgctcgcctctggattccaggaaccgcgaagcccgggctctggacctacatgctgaac
aatactcaccattctcttcaagccttgaaagtgacagtgacctctcgcgcctcccgctca
gcccagcctcctgctactgtggaagcctttgtagaaaaagacagcacctctttcccccat
cccatggtgatttatgcaaatgtgagaaaggggtttaatcccattctcaacgccactgtc
actgctactattgagccagagactgaagatcctgttacgctgaaactttttgataatgga
gcaggtgctgatgttataaaaaatgatggaatttactcgaggtattttttctcctttgct
gtaaatggtagatatagcttgaaagtgcatatcaatcactctcccagcataagcgcccta
ggccactctattccagggagtcatgctatgtatgtgccaggttacataacaaatggtaac
attcagatgaatgccgcaaggaggtcgatgggcaggagcgaggaggagcaaaaggggggc
tttagccggataagctcggggggctccttttccgtgctgggagttccagctggcccccat
cccgatgtgtttccaccatgccaaattatcgacctggcagctgtcaaagtggacgaagag
gtgactctgtcttggacagcacctggagaggacttcgatcagggccaggctaacagctat
gaaataaggatgagtaagagtctacaggatattcgagatgattttaacaacgccattttg
gtgaacacaacaaagctaaatcctcaacaagctggcaccaaggagatatttacattctca
ccaaagcttttcataagtggacctgaacatcaacctgatggagagacacaagaaagccac
agaatttatgtggcaatacgaaccatagataagaactccttaaaatctgcagtatctaac
gttgcccaggcatcactgtttattcccccaaattcggctcctgtacttaccagagatgat
cttatactgaaaggagttttaacggcgatgggtttgataggaatcatttgcctcactata
actgtaacacactatattttaaacaagaaaaagagagcagacagaaaagagaatggaaca
aaattactatga

DBGET integrated database retrieval system