KEGG   Miniopterus natalensis: 107543248
Entry
107543248         CDS       T05883                                 

Gene name
PLCE1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
mna  Miniopterus natalensis
Pathway
mna00562  Inositol phosphate metabolism
mna01100  Metabolic pathways
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04070  Phosphatidylinositol signaling system
mna04919  Thyroid hormone signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05205  Proteoglycans in cancer
Module
mna_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107543248 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107543248 (PLCE1)
   04015 Rap1 signaling pathway
    107543248 (PLCE1)
   04020 Calcium signaling pathway
    107543248 (PLCE1)
   04070 Phosphatidylinositol signaling system
    107543248 (PLCE1)
   04024 cAMP signaling pathway
    107543248 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107543248 (PLCE1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107543248 (PLCE1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107543248 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107543248 (PLCE1)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107543248 (PLCE1)
Membrane trafficking [BR:mna04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107543248 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107543248 (PLCE1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y RA RasGEF EF-hand_like C2
Other DBs
NCBI-GeneID: 107543248
NCBI-ProteinID: XP_016076201
LinkDB
Position
Unknown
AA seq 2354 aa
MTSEEMAASNLIPVTQRKVVSSQSAVDESNEKASDVSVPKAHTVRQSGRASHTISKPNKL
KEESSGSNLPKILSIAREKIMSDENSNETCWEKSMPDSVENLNMNYNNVLENHQCGLPQS
QFYETCDSVTEEGLCLETGIPSSLERKVFPGIQLEIEGRPMGISPLGNQSTVIETSGAHP
NSDLTVFHFHYELDRRMSDTFCTLSNNLILDDCGNCVPLPNVGGEQKKNYMAYACKLMEL
TKSCDNENGQLQCDHCDTMNDEYLCCEGSCRKANMVCSSDSFCREDFTDSPSAETFLSHF
EDFPDNCEDVEDYFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGQAAW
SYIDMKRSGLLLPCGRVTGQLSTVIRQDGSRCLSEAQWYPIYNAVRRGKETEDTIGSLLH
FFTKLPASETAHERINVGPCLKQCVQGTICEYRATLQRTSISQHITGSLLEATTSLGARS
GLLNTFGGSTGRMMLKERQAGTSMANSSSLPSSSAGISKELIDLQPLIQFPEEVASILME
QEQNIYRRVLPVDYLCFLTQNLGTPECQRSLPCLKASISASILNSQNGEHNPLEDLVMRF
NEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNTVMEFLAGLRSRKVLKMWQ
FMDQSDLETMRSLKDAMAQHESSCEYRKVVTRALHIPGCRVVPFCGVFLKELCEVLDGAS
SLVRLRPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQIIRSCSRSL
EMEDEDSPSEGSGSRKNSLKDRARCQFIIGDLLDTENDIFEQPKEWDPHGPEEPQKAFDH
GTELIPWYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWTKPTTASP
ASAKAKLGVLANAPEPGKFPLLGNAGLSGLAEGVLDLFSAKAVYMGHPNIDIHTVCVQNK
LSSMFLAETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQ
WLRKQYVSLYQEEGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKGAEKPNMQRNNTLGI
STAKKKKKVLMRGESGEAADDEMATRKARVHKECRSWSGSDPQDINEHEESEANAITSPP
NPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSNKSPSSAWSSSSWHGRIKGGMKG
FQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDLYAVPCNRSGSESAPLYTNLTIDE
NTSGLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVF
GVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKDNFAS
KNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWD
GDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFK
TVFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASM
QAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYTEE
IPKRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLST
LNASGSSRGKERKSRKSIFGNNPGRMSPGETASLNKTSGKSSYEGIRQAWEESSSPLSPT
TSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPL
MFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERD
LDNMEPAVYSLTVSVAFLNMHSFRIQGITRLSCHSLVHADLVPKRISLRLKSGGRGSVDR
GKDLWVADRKEGHGNLCCPTHSAGSPCVEVDVLGAPLDSCHFRTKPIHRNTLNPMWNEPF
FFRAHFEDLLFLRFAVVENNSSAVTAXFPNGPRGYRHLQLRNLHNEVLEISSLFINSRRM
EENSLGSSVPASLMFSTEERKCLQTHRVTVHGVPGPEPFTVFSINGNTKAKQLLQQILTT
QQDTKPIATDYFLMEEKYFISKEKNECRKQPFQRAIGPDEEIMQILSSWFPEEGYVGRIV
LKTQQETLEERSIVQDDREVVLSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQT
LCKAKYSYSILSNPNPSDYVLLEEVVKDPANKKSSTPKSSQRVLLDQECVFQAQSKWKGA
GKFILKLKEQVQASREDKRKGISFASELKKLTKSTKQPRGLASPSQALASESVQSKEERP
AGGLPAGDATDGRQ
NT seq 7065 nt   +upstreamnt  +downstreamnt
atgacttctgaagaaatggcagcttctaatctcatacctgtgactcagagaaaagtggtg
tcttctcagtcagctgtagatgaaagtaatgaaaaggcttcagacgtcagtgttccaaag
gcacacactgtcaggcagagtgggcgggcttctcataccatctcaaaaccaaacaaactt
aaagaagaatcttctggaagcaacttgcctaagattctctcgatagcaagggagaaaata
atgagtgatgaaaacagtaatgaaacatgctgggagaaaagcatgccagattctgtggaa
aaccttaacatgaactataacaacgtattggaaaaccatcagtgtggtcttcctcagagc
caattttatgaaacatgtgattctgtcacagaggaaggcctctgtttggaaactggaatc
ccttcttcactggaaagaaaggtgttccctggaattcaactggaaatagagggacgtccc
atgggcatcagtcccttaggaaatcaatcgacagtcatagagaccagtggcgcacaccct
aacagcgacttgacagtatttcactttcattatgaacttgacagaagaatgtcagacact
ttctgtaccctatcaaataacttgattttggatgattgtggaaactgtgttccactgcct
aatgttggtggggagcaaaagaaaaattatatggcatatgcttgtaaactgatggaattg
acaaaaagctgtgataatgagaacgggcagctacagtgtgatcattgtgacaccatgaat
gatgaatacttgtgctgtgaaggttcctgccgaaaggccaatatggtatgttcaagtgac
agcttttgcagggaggattttactgatagtccatctgccgagacctttctgagccatttt
gaggacttccctgataattgtgaagatgtagaagattattttaaaagtaaaaaggagcgg
tccactttattagtaaggagattttgtaaaaatgacagggaagttaagaaatctgtgtat
actgggacaagggcaattgtgagaactctgccttctggccacattggacaggcagcttgg
agttacattgatatgaagagaagtggtctcttactgccatgtgggagagtaacgggccag
ctgtcaacagtgattaggcaagatgggagccgatgtctgtcagaagcccagtggtatccg
atctacaatgcagtgagaaggggaaaagaaacagaagatacaattggatctcttctccat
ttcttcacaaagctcccagcctccgagacagcccatgaaaggattaacgttggtccctgc
ttaaagcaatgtgtccaaggcaccatatgtgagtatcgtgccaccctccaaaggacctcc
atatctcagcacatcaccggttctctcctagaagcaaccacatctttaggagcaagaagt
ggccttctcaatacttttggaggttccaccggacgaatgatgctgaaagaacgccaagca
ggcacctctatggccaactccagctccctcccttcaagttcagctgggatcagcaaggaa
ctgattgatctgcagcccctcatccagttccctgaggaagttgccagcatcctgatggag
caggaacagaatatttaccgaagggtcttgccagttgactatctttgcttcttgacccag
aacttgggtactccggaatgtcagaggtccctgccctgcctcaaagcatccatctcagca
tcaattcttaactcccagaatggagaacacaacccccttgaagatcttgtgatgagattt
aatgaggtgagctcctgggtgacgtggctgatcctcacggcgggctccatggaggagaag
cgggaggtcttctcatatttggtgcatgtagccaaatgctgctggaacatgggcaactac
aacactgtcatggagttcttggccgggctcaggtcaagaaaagttttaaaaatgtggcag
ttcatggaccagtctgacctggagaccatgaggagcctgaaggatgccatggctcagcat
gaatcctcctgcgagtacaggaaggtggtgacgcgggcgctgcacatccccggctgcagg
gtggtcccgttctgcggggtgtttctgaaggagctctgtgaggtgctcgatggtgcctcc
agcctcgtgaggctccgcccaagatacaattcccaagaggaaactctggagtttgtagcc
gactacagtggacaagataattttttacaacgagtgggacaaaatggcttgaagaattcg
gagaaagagtccaccgtcaacagcatctttcagatcatcaggagctgcagtcgcagcctg
gagatggaagacgaggacagccccagcgaagggagcggctctcggaaaaactccttgaag
gacagagctcgatgccagtttataattggagatttgctggatacggaaaatgacatcttt
gagcagcccaaagaatgggaccctcatggaccagaagagccacagaaggcctttgaccat
gggacagagctcatcccgtggtacgtcctgtccatccgagctgacgtgcaccagttcctg
ctgcagggggccacagttatccactatgaccaggacacacacctgtccgcccgctgcttc
ctccagcttcagcctgacaatagcaccttgacctggacaaagcccaccactgcctcccca
gccagtgctaaagcaaaacttggtgtgctggctaacgcacccgagcctggcaaattccca
ttgctgggcaacgctggattaagtggcctggcggagggggtcttggatctgttttctgca
aaggctgtgtacatgggacaccccaacattgatatacacactgtgtgtgttcagaacaaa
ctgagtagcatgtttctggcagagacgggtgtgacgctgctctatgggcttcagaccact
gacaacagattgctgcactttgtggcaccgaagcacacagctaaaatgctcttcagtggg
ttgctggaactcacaagagctgtgagaaagatgaggaagttccctgaccaaagacagcag
tggctgcggaaacagtacgtcagcctctaccaggaagaagggcggtatgaaggcccgact
ctggcccacgctgtggagttgtttggcggcagacgatggagtacccggaaccccagcccc
gggacatcagcgaagggcgccgagaagcccaacatgcagaggaacaacaccttgggcatc
agcaccgccaagaagaagaagaaagtccttatgaggggggagagtggagaggcagccgac
gacgagatggccacccgaaaggccagagtgcacaaggagtgtcggagctggagtggctct
gatccccaggacattaatgagcacgaagaatcggaggcgaatgccatcacaagcccacct
aaccctctcccttccagaagagcccactctctgaccacggctgggtcccccaacttggct
gccgggacgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcaaacaagagc
ccgtccagtgcttggagcagcagcagctggcatggccgcatcaaaggaggaatgaaaggc
tttcagagcttcatggtttccgacagtaacatgagtttcgttgaatttgttgagctgttc
aaatccttcagtgtaaggagccgcaaggacctgaaggacctcttcgacctctacgccgtg
ccctgcaaccggtcaggctctgagtcggctccgctctacaccaacctaaccatcgacgaa
aacaccagcggcctgcagcctgacctggatttgttgaccagaaatgtctcggatttgggg
ttgttcattaaaagtaaacagcaactgtcagacaaccagaggcagatctctgacgccatt
gctgctgcaagtatcgtgacgaatggcactggggtcgagagcacatccctgggcgtattt
ggggttggcatactccagctcaatgacttcctagtcaactgccaaggagaacactgcacg
tatgatgagatcctcagcatcatccagaagtttgagcctagcattagtatgtgtcatcag
ggcctaatgtcatttgaaggatttgcaagatttctgatggataaagataattttgcctca
aaaaatgatgagtcccaagagaacattaaagaattacagctgcccctctcctactattac
attgaatcttcacacaatacctacctcacaggccatcagctcaaaggagaatcctcagta
gaactctacagccaggtcctcctgcaaggctgtaggagcgtagagttggactgctgggat
ggagatgacgggatgcccatcatttatcatggacatacactgacaaccaagatccccttc
aaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctgccaatcatc
atatcaattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaattttcaag
actgtgtttggagaaaaactggtggctaaattcttatttgagagtgatttctcagatgat
ccgatgcttccttcacctgaccaacttagaaggaaggtgcttcttaaaaataagaagcta
aaagcccatcagacaccagtggatatcttaaagcaaaaggctcaccagttagcatccatg
caagctcaggcttacaatggtgggaatgccaaccccccacctgctaataacgaggaggaa
gaagatgaagaagacgagtatgattatgactatgagtccctgtcggacgacaacattcta
gaagacagacctgaaaacaagtcatgcaatgacaaacttcagtttgagtatactgaggaa
atccccaaaaggataaagaaagcagataactctgcttgcaacaaaggaaaggtgtatgac
atggagttgggagaagaattttatcttcctcagaataaaaaggaaagcagacagattgcg
ccagagctttccgaccttgtcatctattgccaagcggtaaaatttccaggcctgtcaact
ctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggc
aacaatccgggcagaatgagccccggggagacggcatcacttaacaaaacatctggaaaa
agttcctatgaaggaattcgacaggcgtgggaggaatcttcttcccccctcagcccaacc
acatccctcagcgctatcattagaactcccaaatgttaccatatctcatcgctgaatgaa
aatgccgccaaacgtctgtgtcgcaggtattctcagaaattgatccagcacaccgcctgc
cagctgctgaggacttacccggctgccacccgcatcgactcctccaaccccaaccccctc
atgttctggctgcatgggatacagctggtggcactcaactaccagacagatgatctccct
ttacatttaaacgctgccatgtttgaggccaacggcggctgtggctatgttttgaaaccc
ccagttctgtgggacaagaactgtcccatgtatcagaagttttctcccttggaaagggac
ctggacaacatggagcccgccgtctattctttaactgtaagtgtggccttcctgaatatg
cactcgtttagaattcaaggcattacaaggctctcctgtcacagtttggttcatgcagat
ctagttcccaaaaggatttctttacgtcttaaaagcggtggccgcggttcagtggacaga
ggaaaagacctctgggtggctgataggaaagagggacacggtaacctctgctgtccaacc
cacagcgccggcagcccgtgcgtggaggtggacgtcctgggcgcgccgctggacagctgc
cacttccgcacgaagcccatccaccgcaacaccctgaaccccatgtggaacgagccgttt
ttcttccgggctcacttcgaggacctcctcttcctgcggtttgcggtcgtggagaacaac
agctcggccgtcacggcgnccttcccaaatggcccccggggatatcgacatctccagctg
cgaaacctccacaatgaggtcttggaaatctctagcttattcataaacagcagaaggatg
gaagaaaactccttgggcagctctgtgccggcctctttgatgttcagtacagaagaaaga
aaatgtctgcagactcacagagtcacggtgcatggggtcccaggtccagagccctttact
gtcttctctataaatggaaacaccaaggcaaagcagcttctccaacaaatcctgaccact
caacaagacaccaaacctattgccacagactattttttgatggaagaaaaatattttata
tccaaagaaaagaatgaatgcagaaaacaaccgttccagagagccattggtccagatgaa
gagatcatgcagattttaagcagctggtttccagaagagggatatgttggcaggattgtc
ttaaaaacccagcaggaaaccctagaagagagaagcattgttcaagatgacagagaggtg
gtcttgagctcggaggaggagagtttctttgtccaggtgcacgacgtctctccggagcag
ccgcggaccgtcatcaaggcgcctcgcgtcagcaccgcgcaggacgtcattcagcagacc
ttgtgcaaagccaagtactcctacagcatcctgagcaacccgaacccgagcgactatgtc
cttttggaagaggtggtgaaagaccccgccaacaagaagtcttccacccccaagtcctcc
cagcgggtgcttttggatcaggagtgtgtgtttcaagcccagagcaagtggaaaggtgca
gggaaattcatccttaagctaaaggagcaggtgcaggcatcccgagaagacaagagaaaa
ggcatttcttttgcaagtgaactcaagaagctcaccaagtcaaccaagcagccccgagga
ctcgcttcgccttctcaggccttggcctcagaaagtgtccaaagcaaggaggagagacct
gcaggcggcctgcccgccggggacgcgacggacggtcgacagtga

DBGET integrated database retrieval system