KEGG   Miniopterus natalensis: 107543503
Entry
107543503         CDS       T05883                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04670  Leukocyte transendothelial migration
mna04912  GnRH signaling pathway
mna04915  Estrogen signaling pathway
mna04926  Relaxin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05219  Bladder cancer
mna05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107543503 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107543503 (MMP2)
   04915 Estrogen signaling pathway
    107543503 (MMP2)
   04926 Relaxin signaling pathway
    107543503 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543503 (MMP2)
   05205 Proteoglycans in cancer
    107543503 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    107543503 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107543503 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107543503 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107543503 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mna01002]
    107543503 (MMP2)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     107543503 (MMP2)
Peptidases and inhibitors [BR:mna01002]
 Metallo peptidases
  Family M10
   107543503 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 107543503
NCBI-ProteinID: XP_016076555
LinkDB
Position
Unknown
AA seq 594 aa
MLKDTLKKMQKFFGLPETGVLDKRTIMTMRKPRCGNPDVANYNFFPRKPKWDKSEITYRI
INYTPDLDSETVEDAFSRAFQVWSAVTPLRFSRIHDGEADIMIDFGRWEHGDGYPFDGKD
GLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFRFNGKEYTSCT
DTGRSDGFLWCSTTYDFDKDGKYGFCPHEALFTTGGNADGKPCKFPFQFQGTSYNSCTTE
GRSDGYRWCSTTEDYDRDKKYGFCPETAMSTVGGNSKGAPCVFPFTFLGKKYERCTSEGR
NDGKLWCSTTSSFDEDREWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYT
KNFRLSQDDIKGIQDLYGPSPDGDIDTGTGPTPTLGPVTPEICVQDIIFDGISQIRGEIF
FFKDRFIWRTVTPGEKPTGPLLVATFWPELPERIDAVYEAPQEEKAVFFAGNEYWVYSAS
TLEPGYPKPLTSLGLPPDVERVDAAFNWSKNKKTYIFAGNKFWRYNEVKKKMDPGFPKLI
EEAWNAVPDNLDAVVDLQGGGHSYFFQGIFYMKLENQSLKNVKVGSIKSDWLGC
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgctgaaagacacgctgaagaagatgcagaagttcttcgggctacccgagacaggtgtc
ctcgacaagcgcaccatcatgaccatgcggaagccgcgctgcggcaaccccgacgtggcc
aactacaacttcttcccccgcaagcccaagtgggacaagagcgagatcacatacaggatc
attaactacacgcctgatctcgactccgagacggtggaagatgccttctcccgtgccttc
caagtctggagtgctgtgaccccccttcggttttcccgtatccacgacggagaggcagac
atcatgatcgacttcggccgctgggagcatggagatggatacccctttgacggcaaggac
ggactcctggctcacgccttcgccccgggccctggtgttgggggagactcccactttgac
gacgacgagctgtggaccctgggagaggggcaagtggtccgtgtgaagtacggcaacgcc
gacggggagtactgtaagttccccttccggttcaacggcaaggagtatacgagctgcacc
gacaccggccgcagcgacggcttcctctggtgttccaccacctacgacttcgacaaggat
ggcaaatacggcttctgcccccacgaagctttgttcaccacgggtggcaacgccgacgga
aagccctgcaagttcccgttccagttccagggcacgtcctacaacagctgcaccaccgag
ggccgcagcgacggctaccgctggtgcagcaccaccgaggactacgaccgtgacaagaag
tacggcttctgccctgagaccgccatgtccactgttggcggaaactcaaaaggtgccccc
tgcgtcttccccttcaccttcctgggcaagaagtatgagcggtgcaccagcgagggccga
aacgacgggaagctgtggtgctccaccacgtccagcttcgacgaggaccgcgagtggggc
ttctgcccggaccaagggtacagcctgttcctggtggcggctcatgagttcggtcacgca
atggggctggagcactcgcaggaccctggagccctgatggcgcccatttacacctacacc
aagaacttccgcctgtcccaggatgacatcaagggcattcaagacctctacgggccctct
cctgatggtgacattgacactggcaccggtcccacccccactctgggacctgtcactcct
gagatctgcgtacaggacatcatctttgatggcatctctcagatccgcggggagatcttc
ttcttcaaggaccggttcatctggcggaccgtgacgccaggtgaaaagcccacggggccc
ctgctggtggccacattctggcctgaacttccagaaaggatcgatgccgtgtacgaggcc
ccgcaggaggagaaggcagtgttctttgcagggaatgaatactgggtttattcagccagc
accctggagccggggtaccccaagcctctgaccagcctggggctgccccctgatgttgaa
cgagtggatgctgcctttaactggagcaagaacaagaagacgtacatctttgctggaaac
aagttctggagatacaatgaggtgaagaagaaaatggaccccggcttccctaagctcatc
gaagaagcctggaacgccgtccctgataacctggacgccgtggtggacctccagggcggc
ggtcacagctactttttccagggcattttttacatgaagttggagaaccaaagcctgaag
aacgtgaaggttggaagcatcaaatccgattggctgggctgctga

DBGET integrated database retrieval system