KEGG   Miniopterus natalensis: 107543566
Entry
107543566         CDS       T05883                                 

Gene name
RGS2
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
mna  Miniopterus natalensis
Pathway
mna04022  cGMP-PKG signaling pathway
mna04740  Olfactory transduction
mna04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107543566 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107543566 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    107543566 (RGS2)
SSDB
Motif
Pfam: RGS DUF3454
Other DBs
NCBI-GeneID: 107543566
NCBI-ProteinID: XP_016076617
LinkDB
Position
Unknown
AA seq 205 aa
MTVVWGVRGYSSNFNCCHFNESFFFFSFLFRLKDWKTRLSYFLQHSSSPEKPKTSKKNKQ
QTFLRPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQ
KLSSKAKKIYTDFIEKEAPKEINIDFQTKTLIAQNIQDATSGCFTTAQKRVYSLMENNSY
PRFLESEFYQDLCKKPQITTEAHAT
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacggttgtatggggggtgcgtggctacagtagcaatttcaactgttgccactttaat
gaatctttttttttcttctcttttctttttagactgaaagattggaagacccgtttgagt
tacttcttgcaacattcttcctctcctgagaagcccaaaaccagcaagaagaacaaacag
caaaccttcctcaggccttctcccgaggaagcacagctgtggtcagaagccttcgacgag
ctgctagccagtaaatatggtcttgctgcattcagggcttttttaaaatctgaattctgt
gaagaaaatattgaattctggctggcctgtgaagacttcaagaaaaccaagtcaccccaa
aagctgtcctcaaaggcaaagaaaatatatactgacttcatagaaaaagaagccccgaaa
gagataaacatagactttcaaaccaaaactctaattgcccaaaacatccaagatgctaca
agtggctgctttacgacagcccagaaaagggtgtacagcctgatggaaaacaactcctac
ccccgtttcctggagtcagaattctaccaggatttgtgtaaaaagccgcagatcaccaca
gaggcccacgctacatga

DBGET integrated database retrieval system