KEGG   Miniopterus natalensis: 107543674
Entry
107543674         CDS       T05883                                 

Gene name
NR0B1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    107543674 (NR0B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107543674 (NR0B1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mna03310]
    107543674 (NR0B1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    107543674 (NR0B1)
Nuclear receptors [BR:mna03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   107543674 (NR0B1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 107543674
NCBI-ProteinID: XP_016076743
LinkDB
Position
Unknown
AA seq 378 aa
MSGEHRQWPGSILYNMLTSAKQTHEASEAQGAPRARPGGLCWGCSCGAEPPVGRDGLSGR
RTVAVLYRCCFCGEDHPRQGSILYHMLTSAKQMQEAPEALRGACWGCSCGAEPPAAREVA
PGGRPVALLYRCCFCGGEHPRQGSIFYNMPTGSKQMHAAQPVVCEAASAGLLKTMRFVKY
LPCFQVLPLDQQLVLVRSGWAPLLMLELAQDRVNFETVETLEPSWLQSVLTTRRREPSGE
EPTTPASTLQPRSAPQPEAGTAAAEVQAIKGFLVKCWSLGISTKEYAYLKGIVLFTPDLP
GLRCVKYIQGLQWGTQQILGEYTRMTYRGYHARVAELNSVLFQLRFINANAVAELFFRSI
IGTVSMDDMMLEMLCTNL
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgtcgggcgagcaccgccagtggcccggcagcatcctctacaacatgctcacgagcgct
aagcaaacgcacgaggcttcggaagcacagggggcgcccagggcgcggcccgggggcctg
tgctggggctgctcctgtggcgcggagccccccgtgggtagagacgggctgtccggtagg
cggacggtggcggtcctgtaccgctgctgcttttgcggtgaagaccacccacggcaagga
agcatcctctaccacatgctcacgagcgcgaaacaaatgcaagaagcccccgaggcgctg
cggggcgcgtgctggggctgctcctgcggcgcggagcccccggcggccagagaggtggcg
ccgggcgggaggcccgtggcgctcctgtatcgctgctgcttttgcggcggcgagcaccca
cggcagggcagcatcttctacaacatgcccacgggctcaaaacaaatgcacgcggctcag
ccggtggtctgcgaggcagcctcggcgggcctgttgaagacgatgcgcttcgtcaagtac
ttaccctgtttccaggttctgcccctggaccagcagctggtgctggtgcgcagcggctgg
gcgccgctgctcatgcttgagctggcccaggaccgcgtcaatttcgagaccgtggagacc
ttggagcccagttggctgcagagcgtcctcaccaccaggcggcgggagccctcgggagag
gagcccacnacgcctgcctccacgctgcagccgcgctcggcaccgcagccggaggcgggc
accgcagccgccgaggtccaggctattaagggcttccttgtcaagtgctggagcctgggc
atcagcaccaaggagtacgcctacctcaaggggatcgtgctcttcaccccggacctgccg
ggcctgcggtgcgtgaagtacattcagggacttcagtggggaactcagcagatcctcggc
gagtacaccaggatgacatacagggggtaccacgccagagtcgctgaactgaatagtgtc
cttttccagcttagattcatcaacgccaatgccgttgcggaactgttcttcaggtccatc
attggcacagtcagcatggatgatatgatgctggaaatgctctgtactaatttataa

DBGET integrated database retrieval system