KEGG   Miniopterus natalensis: 107543706
Entry
107543706         CDS       T05883                                 

Definition
(RefSeq) DNA mismatch repair protein Msh3-like
  KO
K08736  DNA mismatch repair protein MSH3
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03430  Mismatch repair
mna05200  Pathways in cancer
mna05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    107543706
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543706
  09162 Cancer: specific types
   05210 Colorectal cancer
    107543706
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107543706
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107543706
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     107543706
SSDB
Motif
Pfam: MutS_V MutS_I MutS_II MutS_III MutS_IV
Other DBs
NCBI-GeneID: 107543706
NCBI-ProteinID: XP_016076774
LinkDB
Position
Unknown
AA seq 1074 aa
MSVFRCGLAVTSWLTFGCGLAVTSCLTSPTQAANTDASARRPPESDGPVEKRAKRARDGG
GRGDSAPGSPESRKCLRTRIVLKSLEKLKEFCRDSALPQNQVQREPLQERFAVLPKCTDF
DDISLLRAKNAVSSQESRSQTSQKDKTLSDLSHFGSPHGSCENLQKIPDSKPPNKRTKSI
YTPLELQYIEMKQQQKDAILCVECGYKYRFFGEDAEIAARELNIYCHLDHSFMTASIPAH
RLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKSSLFARKLTALYTKSTLIGEDVSPLA
QLGDALHADETVTDASSGCLLCICENIKDKKKGNVFVGVVGVQPATGAVVFDSFQDSGAR
SELETRMLCLQPVELLLPSHLSEQTESLIHRVTAASVRDDRIRVERMDAMYFEYSHAFQV
VTEFYAKDVVDIKGSQSFSDIINLEKPVICSLAAIIRYLKDFNLAKVLSKPKNFKQLSSE
MEFMTINGTTLRNLEILQNQTDMKTKGSLFWVLDHTKTSFGRRKLKKWVTQPLLKLRSED
KNAYRKVSVVECDLQPAGPFIGRTRIVKTYFYFQCSTKEFFLIVKTLYHLKSEFQALIPA
VNSHVQSDLLQTLILEIPELLSPVERYLKVLNEQAAQIGDKTELFKELSDFPLIRKRKDE
IQGVTDKIQMHLQDIRKLLKNPSAQYVTVSGQEFMIEIKNSAVSCIPSDWIKVGSTKAVS
RFHSPFIVESYRHLSQLREQLVLDCSAEWLDFLENFNEHYHSLCKAVHHLATVDCVFSLA
KVTKQGDYCRPTVLEERKIIIKNGRHPVIDVLLGEQDQYVPNSTSLSGDSERVMIITGPN
MGGKSSYIKQVALITIMAQMGSYVPAEEATIGIVDGIFTRMGAADNIYKGRSTFMEELTD
MAEIMRKATSQSLVIVDELGRGTSTHDGIAIAYATLEHFIRDVRSLTLFVTHYPPVCELE
KRYSQQAGNHHMGFLVGEGERGPEPGEEAPGSVTFLYQITRGMAARSYGLNVAKLADVPG
EILKQAASKSEELEGLVNMKRKRLKCFTKFWTIKDAKDLRTWADEFEVEGMADS
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtctgtcttccggtgtggcttagcggtgacgtcatggctgactttcggttgtgggctg
gcggtgacgtcatgtctgacttcccccacacaggccgcaaacaccgacgcaagcgccagg
agacccccggagagtgacgggcctgttgaaaagcgagcaaagcgagcccgggacgggggc
ggccgcggtgactcggcgccggggagccccgagtcaaggaaatgtctgaggaccaggatt
gttttaaagtctctggaaaaattgaaagaattctgccgcgattctgcccttcctcaaaat
caagtccagagagagcctcttcaggagagatttgcagttctgccaaaatgtactgatttc
gacgatatcagtcttctgcgtgcaaagaatgcagtttcttcccaagagtccagatctcaa
actagtcagaaggacaagacactttctgatctcagtcattttggatcaccacatgggagt
tgtgaaaacttacagaaaatccctgattctaaaccacctaacaaaagaaccaaaagcatc
tacacgccattagaattacagtacatagaaatgaagcagcagcagaaagatgcaattctg
tgtgtggaatgtggatataagtatagattctttggggaagatgcagagattgcagcccgg
gagctcaatatttattgccacttagatcacagcttcatgacagcgagcataccggctcac
agactgtttgtgcacgtgcgccgccttgtggcaaagggatataaggtaggagttgtgaag
cagactgaaacagcagcgctgaaggccattggggacaacaaaagttcactatttgcccgg
aaattgactgctctttatacaaaatctacacttattggagaagatgtgagccctttggcc
cagctgggtgacgctctccatgccgacgagacggtgactgacgcctccagtggctgtctt
ctgtgcatctgtgaaaacattaaggacaaaaaaaaggggaacgtttttgttggagttgtg
ggagtgcagcctgccacgggagcggttgtgtttgatagtttccaggactctggtgcccgt
tcagagctggaaactcggatgctgtgcctgcagccggtggagctgctgcttccatcacat
ttgtcagagcagacggagtcgctcatccacagggtcacagctgccagtgtgcgggatgac
agaattcgagtagaaaggatggatgccatgtattttgaatacagccatgctttccaggtg
gtcacagaattttatgcaaaagatgtggttgacatcaaaggttcccaaagtttttctgac
atcattaacttggagaagcctgtgatttgctctttggctgctataataagatacctcaaa
gactttaacttggcaaaggtgctttccaaacccaagaattttaaacagttgtcaagtgaa
atggaatttatgacaattaacggaacaacattaaggaatcttgaaatactacagaatcag
actgatatgaaaaccaaaggaagtttattttgggttttagaccatactaaaacttcattt
gggagacggaagttaaagaagtgggtgactcaaccactccttaaattaagatcagaagac
aaaaatgcctataggaaggtctctgtggttgaatgtgacttgcaaccagctggcccattt
attgggagaactcgtatagtaaaaacgtatttctattttcagtgttctaccaaagaattc
ttcttgattgtcaaaaccctttatcacctgaagtcagaatttcaagcattaatacctgct
gttaattcccacgttcagtcagacctgctccagacacttattttagaaattcctgagctc
ctcagtccagtggagcgttacctaaaggtccttaatgagcaagcagcccaaattggggat
aaaactgaattattcaaagaactttctgatttccctctaataagaaagaggaaggatgaa
attcaaggagtgacggacaagatccaaatgcatttgcaagacataagaaaactactgaaa
aatccctccgcacagtatgtgacagtatcaggacaggagtttatgattgaaataaagaac
tctgctgtatcttgtataccatctgattggattaaagttggaagcacaaaagctgtgagc
cgcttccactctcctttcattgtagaaagttacagacatctgagtcagctccgggagcag
ctggtcctggactgcagtgctgaatggctggattttctagagaatttcaatgaacattat
cactccctgtgcaaagcagtacatcacctagcaactgttgactgcgttttctccctggcc
aaggtcactaagcaaggcgattactgcagaccaactgtgctagaagaaaggaaaatcatc
ataaaaaatggccggcaccctgtgattgacgtgttgctgggcgaacaggatcagtatgtt
cccaacagtacaagtttatcaggagactcagagagagtgatgataatcactggaccaaac
atgggtggaaagagctcctacataaaacaagttgcactgattacaatcatggctcagatg
ggctcctatgttcctgcagaggaagcgaccattggaattgtggatggcattttcacgagg
atgggtgctgcagataatatatataaaggacggagtacttttatggaagaactgactgac
atggcagaaataatgagaaaagccacgtcacaatccttggttattgtggatgaactggga
agagggacgagcacccatgatgggattgccattgcttatgctacacttgagcattttatt
agagatgtgcgatccttaaccctgtttgtcacccattatccgccagtgtgtgaattagag
aaacgttactcccagcaggcggggaaccaccacatgggcttcttggtcggggagggtgag
cgcggacccgagccaggtgaggaagcccctggttctgtcacttttctttatcagatcacc
agaggaatggcagcgaggagttacggactgaatgtggctaagctggcagacgttcctgga
gaaattttaaagcaagcagccagcaagtcagaagagctggaaggattagtaaatatgaag
aggaaaaggctaaagtgttttacaaaattctggacaataaaggatgccaaagacctgcgg
acgtgggcagatgagtttgaagtggaaggcatggcagactcctga

KEGG   Miniopterus natalensis: 107544300
Entry
107544300         CDS       T05883                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03430  Mismatch repair
mna05200  Pathways in cancer
mna05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    107544300 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544300 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107544300 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107544300 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107544300 (MSH6)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     107544300 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 107544300
NCBI-ProteinID: XP_016077634
LinkDB
Position
Unknown
AA seq 1365 aa
MSRQSTLYSFFPKSPAGLSNASKAPGKASGEGGAAAATAASPFPSGDVAWSEDEPGPGPG
PGPLASSASPPQPRNLNGGLRRSTAPAVSSSSCDFSPGDLVWAKLEGYPWWPCLVYNHPF
DGTFIREKGKSARVHVQFFDDSPTRGWVSRRLLKPYTGSKSKEAQKGGHFYSGKPEILRA
MQRADEALNKDKIKRLELAVCDEPSEPEEEEVEVGATYASDKSEEDNEIESEEEVRPKVQ
GSRRSSRQIKKRRVISDSESDIGGSDVEFKPDAKEEGSSDEISSGVGDSDSEGLHSSVKV
APKRKRMVTGNGSLKRKSSRKEMPPVKKRATGISSETRSTLCAFSAPQSSESQAHISGGC
DDSSRPTVWYHETLEWLKEEKRRDVHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQI
KSQNFDLVIFYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQK
GYKVARVEQTETPEMMEARCRKMAHISKHDRVVRREICRVITKGTQTYSVLEGDPSENYS
KYLLSLKEKEEETSGHTRVYGVCFVDASLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLF
EKGNLSTETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLEEGYFTEKLNENNGVMLP
QVLKGMTSEADSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDM
VSATRPGAVFSKANQRMVLDSVTLNNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQ
WLCAPLCNPFAINDRLDAIEDLMVVPDKITEVVDLLKKLPDLERLLSKIHNVGSPLRSQK
HPDSRAIMYEETTYSKKKIIDFLSALEGFKAICKIIGIMEEVIDDFKSKILKQVITLQTK
NSEGQFPDLTIELNRWDTAFDHEKARKTGVITPKAGFDSDYDQALADIKENEQSLLEYLE
KQRSRIGCRTIVYWGIGRNRYQLEIPENFITHNLPEEYELKSTKKGCKRYWTKTIEKKLA
NLINAEERRDVSLKDCMRRLFYNFDKNYKNWQAAVECIAVLDVLLCLANYSRGGDGPMCR
PVILLPKDDTAVFLDLKGSRHPCITKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGP
NMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRIFTRLGASDRIMSGESTFFVELS
ETASILTHATAHSLVLVDELGRGTATFDGTAIASAVVKELAENIKCRTLFSTHYHSLVED
YSQNVAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQK
GHRKAREFEKMTHSLRLFREVCLASERSNIDAEAVHKLLTLIEEL
NT seq 4098 nt   +upstreamnt  +downstreamnt
atgtcgcgacaaagcacgctgtacagcttcttccccaagtctccagcggggctgagtaat
gccagcaaggccccgggcaaggcctcaggtgaaggcggcgctgccgctgccaccgcggcc
tcccccttccccagcggggatgtggcctggagtgaggacgagcctgggcctgggcctggg
cctgggcccttggcgagctccgcgtccccgcctcagccgaggaacctcaacggagggctg
cggaggtcgacagctcctgcagtctcctccagctcttgtgacttctcaccaggtgatttg
gtttgggccaagttggagggttacccctggtggccttgcctggtttacaaccaccctttc
gatggaacattcatccgtgagaaagggaagtctgcccgagttcacgtacagttttttgat
gacagcccaacaaggggctgggttagcagaaggctattaaagccatatacaggttcaaaa
tcaaaggaagcccagaaaggaggtcatttttacagtggaaaacctgaaatactcagagca
atgcaacgtgcagatgaagccttgaataaagacaagattaagaggcttgaattggcagtg
tgtgatgagccctcagaaccagaggaggaagaagtggaggtaggtgcaacttacgcatca
gataagagtgaagaagataatgaaattgagagtgaagaggaagttcggcctaaggtgcaa
ggatctcggagaagtagccgccaaattaaaaaacggagagtcatatcagactctgagagc
gacattggtggctctgatgtagaattcaagccagacgctaaggaggaaggaagcagtgat
gaaataagtagtggagtgggggatagtgacagtgaaggccttcacagctctgtcaaagtt
gctccgaagaggaagagaatggtgactggcaatggctctctcaaaaggaaaagttcaagg
aaggaaatgcccccagtcaaaaaacgagcaactggcatttcatcagaaaccaggagtact
ttgtgtgctttctctgccccgcaaagttccgaatcccaagcccacattagtggaggatgt
gatgatagcagtcgccccactgtctggtatcacgaaactttagaatggcttaaggaggaa
aaaagacgagatgtgcacaggaggcgacccgatcatcccgattttgatgcatctacactg
tatgtccctgaggatttccttaattcctgtactcctgggatgaggaagtggtggcagatt
aaatctcagaactttgatcttgtcatattttataaggtggggaagttttatgagctgtac
cacatggatgctcttattggagtcagtgaactagggctggtattcatgaaaggcaactgg
gcccattctggtttccctgaaattgcatttggcagatactcagattctctggtccagaag
ggctataaagtagcacgagtggaacagactgagaccccagaaatgatggaggcaagatgc
cgaaagatggcacatatatctaagcatgatagagtggtgaggagggagatttgtagggtc
attaccaagggcacacagacgtacagtgtgttggaaggtgacccctctgagaactacagt
aaatatcttcttagcctcaaagaaaaagaggaagagacttctggccacactcgagtgtat
ggtgtatgctttgttgatgcctcactgggaaagtttttcataggtcagttttcagatgat
cgccattgttccaggtttaggactctggtggcacattaccctccagtccaagtcttgttt
gagaaaggaaatctctcaacagaaactaagatgattctgaagggctcattatcctcttct
cttcaggaaggtctgataccaggctcccagttttgggatgcagccaaaactttgagaact
ctgcttgaagaaggatattttacagaaaagttaaatgagaacaatggggtgatgttaccc
caagtgcttaaaggtatgacttcagaggctgattctattgggttgacaccaggagagaag
agtgaattggccctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttatt
gatcaggagcttttatcaatggctaattttgaagaatatattcccttggattctgacatg
gtcagtgctacaagacctggtgctgttttttctaaagccaatcaacgaatggtgctagat
tctgtgacactgaacaacttggagatttttctgaatggaacaaatggttctaccgaaggt
accctactagagaagattgatacttgccatactccttttgggaagcggctccttaagcag
tggctatgtgccccactgtgtaacccttttgctatcaatgatcgtctagatgctatcgaa
gatctaatggttgtgcctgacaaaatcactgaggttgtagatcttctaaagaagctccca
gaccttgagagactactgagtaaaattcataatgttgggtctcccttgaggagccagaaa
catccagatagcagggctataatgtatgaagaaactacatacagcaaaaaaaagattatt
gattttctttctgctctggaaggatttaaagcaatatgtaaaattataggcattatggaa
gaagtcatcgatgactttaagtctaaaattcttaagcaggtcattactctgcagactaaa
aattctgaaggtcaatttcctgatttaactatagaactgaaccgatgggatacagccttt
gaccatgaaaaggctcgaaagactggagtgattactcccaaagcaggatttgactctgat
tatgaccaggctcttgctgacataaaagaaaatgagcaaagcctcttggaatatttagag
aaacagcgcagtcgaattggctgtagaaccatagtctattgggggattggtaggaaccgt
taccagttggaaattccagagaatttcatcacccataatttgccagaagaatatgagttg
aaatccactaagaagggctgtaaacgatactggaccaaaactattgagaagaagctggct
aatctgataaatgcggaagaacggagagatgtatccttgaaggactgcatgcggcgacta
ttctataacttcgataaaaattacaagaactggcaggctgctgtagagtgcatcgcagtg
ttggatgttttattgtgcctggctaactatagtcgagggggcgatggtccgatgtgtcgt
ccagtaattctattaccaaaagatgacactgccgtcttcttagaccttaaagggtcacgc
catccctgcattacgaagactttttttggagatgactttattcctaatgacattctaata
ggctgtgaggaggaggaggaagaaaatggcaaagcttattgtgtgcttgttactggacct
aatatggggggcaagtctacactcatgagacaggccggcctattagctgtaatggcccag
atgggttgttatgtacctgctgaggtgtgtaggctcacaccaattgatagaatatttact
agacttggtgcctcagacagaataatgtcaggtgaaagtacattttttgttgaattgagt
gaaactgccagtatacttacacatgcaacagcacattctctggtgcttgtggatgaatta
ggaagaggtactgcaacatttgatgggacagcaatagcaagtgcagttgttaaagaactt
gctgagaatataaagtgtcgtacattgttttctacccactaccattcattagttgaagat
tattctcaaaatgttgcagtgcgtttaggacacatggcatgtatggtagaaaatgaatgt
gaagatcccagtcaagagactattaccttcctttataaattcattaagggagcttgtcct
aaaagctatggctttaatgcagcaaggcttgccaatcttccagaggaggttattcagaag
ggacacagaaaagcaagagaatttgagaagatgactcattcactacgattatttcgggaa
gtttgcctggctagtgaaaggtcgaatatagatgctgaagctgtccataagttgctgact
ttgattgaggaattatag

DBGET integrated database retrieval system