KEGG   Miniopterus natalensis: 107543755
Entry
107543755         CDS       T05883                                 

Gene name
NPR1
Definition
(RefSeq) atrial natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna01100  Metabolic pathways
mna04022  cGMP-PKG signaling pathway
mna04024  cAMP signaling pathway
mna04270  Vascular smooth muscle contraction
mna04714  Thermogenesis
mna04921  Oxytocin signaling pathway
mna04923  Regulation of lipolysis in adipocytes
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107543755 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107543755 (NPR1)
   04022 cGMP-PKG signaling pathway
    107543755 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107543755 (NPR1)
   04921 Oxytocin signaling pathway
    107543755 (NPR1)
   04924 Renin secretion
    107543755 (NPR1)
   04925 Aldosterone synthesis and secretion
    107543755 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107543755 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107543755 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107543755 (NPR1)
Enzymes [BR:mna01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107543755 (NPR1)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107543755 (NPR1)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Peripla_BP_6 DUF3958 CHASE6_C
Other DBs
NCBI-GeneID: 107543755
NCBI-ProteinID: XP_016076832
LinkDB
Position
Unknown
AA seq 1059 aa
MPHPGCPTGAHLRLLLLLPSLLLLLRGSHASNLTVAVVLPLANTSYPWSWARVGPAVQLA
LARVKAQPDLLPGWTVRTVLGSSENVRGVCSDTAAPLAAVDLKWEHKPAVFLGPGCVYAA
APVARFTAHWRVPLLTAGAPALGFGAKDEYALTTRSGPSHAKLGDLVAALHRXXXXERRA
LVLYAYRPGDDQACFFVVEGLYMRVRNLLNITVDHVEFAEDDLDHYSRLLRTVQRKGRVI
YICSSPDAFRTLMLLALEAGLTGEDYVFFHLDLFGQSLQGAHGLGSYRPWERGDGQDVSA
HLAFQAAKIITYKEPDNPEYLEFLQQLKHLAHEQFNFTMEDGLVNTIPASFHDGLLLFVQ
AVTETLAHGGTVTDGEGITQRMWNRSFQGVTGYLKMDSNGDRETDFSLWDMDPETSAFRV
VLNYNGTSQELVAVSGRTLHWPLGYPPPDIPKCGFDNEDPACNQAHFSTLEALALVGSLS
LLSILIVSIFIYRKMQLEKELASELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGS
LLTTEGQFQVFAKTVYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDIQNEHLTRFVGAC
TDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLK
SSNCVVDGRFVLKITDYGLESFRDPEPDQGHTLYAKKLWTAPELLRMASPPARGSQAGDV
YSFGIILQEIALRSGVFHVEGLDLSPKEIIEHVTRGEQPPFRPSLALQSHLEELGHLMQR
CWAEDPQERPPFQQIRLMLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEK
RKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLN
DLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIR
HRPQEQLRLRIGIHTGXVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKA
VLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGNSTRG
NT seq 3180 nt   +upstreamnt  +downstreamnt
atgccccacccggggtgccccaccggcgcccacttgcgcctgctactgctcctgccgtcg
ctgctgctgctgctccggggcagccacgcgagcaacttgacggtggccgtggtgctgccg
ctggccaacacctcgtacccgtggtcgtgggcgcgcgtgggcccggcagtgcaactggcc
ctggccagggtgaaggcgcagccggacttgttgcccggctggacggtccgcacggtgctg
ggcagcagcgagaacgtgcggggcgtctgctccgacaccgccgcacctctggccgcggtg
gacctcaagtgggagcacaagccggccgtgttcctgggccccggctgcgtgtacgccgcc
gccccggtggcgcgcttcaccgcgcactggcgggtgccgctgctcacggccggcgccccc
gcgctgggcttcggggccaaggatgagtacgcgctgaccacgcgctcggggcccagccac
gccaagctgggcgacctggtcgcggcgctgcaccgnnnnnnnnnnnnggagcgccgcgcc
ctcgtgctctacgcctaccggcccggggacgaccaggcctgcttcttcgtggtggagggg
ctgtacatgcgggtccgcaacctcctcaacatcacggtggaccacgtggagttcgccgag
gacgacctcgaccactactccaggctgctgcggacggtgcagcgcaagggccgagttatc
tacatctgcagctccccagatgccttcagaaccctgatgcttctggctctggaagctggc
ctgactggggaggactatgttttcttccacctggatctctttgggcaaagcctgcaaggt
gcacatggccttggttcctacaggccctgggagagaggggatggacaggatgtcagtgcc
cacctcgcctttcaggctgccaaaatcattacatataaagaaccagataatcctgagtac
ttggaattcctgcagcagctaaaacatttggctcatgagcagttcaacttcaccatggaa
gatggcctggtgaacaccatcccagcgtccttccacgacgggctcctgctctttgtccag
gcagtgacagagactctggctcatgggggaactgtcaccgacggggagggcatcactcag
aggatgtggaaccgaagcttccaaggtgtgacaggatacctgaaaatggacagcaatgga
gatcgagagactgatttctccctctgggatatggatcctgagactagtgcctttagggtc
gttctgaactacaatgggacttcccaggaactggtggctgtgtcagggcgcacactgcac
tggcctctaggatacccgcctcctgacatccccaaatgtggctttgacaatgaggaccct
gcctgcaaccaagcccacttttccaccctggaggcgttggctttggtaggcagcctctcg
ctgctcagcatcctgattgtctccatcttcatatacaggaagatgcagctggaaaaggaa
ctcgcctcagagctgtggcgagtgcgttgggaggacttgcagcccagtagcctagagagg
cacctccggagtgcaggcagccggctgaccttgagtgggagaggctccaattatggctcc
ctgctcaccacagagggccagttccaagtctttgccaagacagtgtattataagggcaac
ctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacgagaaaagtcctgttt
gaattgaagcatatgcgggatatacagaatgaacacctgaccaggtttgtgggtgcctgc
accgatcccccgaacatctgtatcctcacagagtactgtccccgggggagcctacaggac
attctggaaaatgagagtatcaccctggactggatgttccggtactctctcaccaatgac
atcgtcaagggtatgctgttcctgcacaatggggccatttgctcccatggaaacctcaag
tcatccaactgtgtggtagacggtcgatttgtcctcaagatcactgactatgggctggag
agcttcagggacccagagccagaccaaggacacaccctctatgcgaaaaagctgtggaca
gcccctgagctcctgcgaatggcctcaccccctgcccggggctcccaggctggtgatgtc
tacagctttgggatcatccttcaggagattgccctgaggagtggcgtattccacgtggaa
ggtttggacctcagccccaaagagatcattgagcatgtgactaggggcgagcagcccccc
tttcggccctccctggccctgcagagtcacctggaggaactggggcacctgatgcagcgg
tgctgggctgaagacccccaggagcggccacccttccagcagatccgcctgatgctgcga
aagtttaacagagagaacagcagcaacatcctggacaacctgctgtcccgcatggagcaa
tatgccaacaacctggaggagctggtggaggagcggacccaggcctacctggaggagaag
cgtaaggccgaggccctgctctaccagatcctgcctcactcagtggctgagcagctgaaa
cgtggggagacagtccaggccgaagcctttgacagcgttactatctacttcagtgacatt
gtgggtttcacggccctgtcggcggagagcacacccatgcaggtggtgaccctgctcaat
gacctgtacacttgcttcgatgccgtcatagacaacttcgatgtgtacaaggtggagacg
atcggcgacgcctacatggtggtgtcggggctcccagtgaggaacgggcggctgcacgct
tgcgaggtggcgcgcatggctctggcgctgctggacgccgtgcgctcctttcgcatccgc
caccggccccaagagcagctgcgcttgcgcatcggcatccacaccggnnnngtgtgtgct
ggtgtggtaggattgaagatgccccgttactgtctctttggggacacagtcaacacggcc
tcaagaatggagtctaacggggaagccctgaagatccacttgtcttctgagactaaggct
gtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatgaagggc
aaaggcaaagttcggacctactggctcctgggggagcgggggaatagcacccgaggctga

DBGET integrated database retrieval system