KEGG   Miniopterus natalensis: 107543787
Entry
107543787         CDS       T05883                                 

Gene name
FASLG
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04060  Cytokine-cytokine receptor interaction
mna04068  FoxO signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04217  Necroptosis
mna04650  Natural killer cell mediated cytotoxicity
mna04722  Neurotrophin signaling pathway
mna04932  Non-alcoholic fatty liver disease
mna04940  Type I diabetes mellitus
mna05022  Pathways of neurodegeneration - multiple diseases
mna05142  Chagas disease
mna05143  African trypanosomiasis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05165  Human papillomavirus infection
mna05168  Herpes simplex virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05205  Proteoglycans in cancer
mna05320  Autoimmune thyroid disease
mna05330  Allograft rejection
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107543787 (FASLG)
   04014 Ras signaling pathway
    107543787 (FASLG)
   04068 FoxO signaling pathway
    107543787 (FASLG)
   04151 PI3K-Akt signaling pathway
    107543787 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543787 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107543787 (FASLG)
   04217 Necroptosis
    107543787 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107543787 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107543787 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543787 (FASLG)
   05205 Proteoglycans in cancer
    107543787 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107543787 (FASLG)
   05330 Allograft rejection
    107543787 (FASLG)
   05332 Graft-versus-host disease
    107543787 (FASLG)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    107543787 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107543787 (FASLG)
   04932 Non-alcoholic fatty liver disease
    107543787 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107543787 (FASLG)
   05161 Hepatitis B
    107543787 (FASLG)
   05160 Hepatitis C
    107543787 (FASLG)
   05164 Influenza A
    107543787 (FASLG)
   05162 Measles
    107543787 (FASLG)
   05168 Herpes simplex virus 1 infection
    107543787 (FASLG)
   05163 Human cytomegalovirus infection
    107543787 (FASLG)
   05165 Human papillomavirus infection
    107543787 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107543787 (FASLG)
   05143 African trypanosomiasis
    107543787 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107543787 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107543787 (FASLG)
   04052 Cytokines and growth factors [BR:mna04052]
    107543787 (FASLG)
   04090 CD molecules [BR:mna04090]
    107543787 (FASLG)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107543787 (FASLG)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Tumor necrosis fators
   107543787 (FASLG)
CD molecules [BR:mna04090]
 Proteins
  107543787 (FASLG)
SSDB
Motif
Pfam: TNF GutM
Other DBs
NCBI-GeneID: 107543787
NCBI-ProteinID: XP_016076879
LinkDB
Position
Unknown
AA seq 277 aa
MQQPLNYPYPQIYWVDSGAPSPWTPPPRTVLPCPSSVPGRPGQRRPPPPPPPQAPPPPLP
PLPLPPLKKRRDHNTGLCLLVMFFMILVALVALGLGMFQLLNLQKELAELRESSSQRHIE
SSLEKQIGHPSPPSEKEEQRKVAHLTGKPNSRSIPLEWEDTYGIALVAGVKYKKGSLVIN
DTGLYFVYSKVYFRGQSCKKQPLNHKVYMRNSKYPQDLVLMEEKMMDYCTVGQMWARSSY
LGAVFNLTSADHLHVNVSELSLVNFEESKTFFGLYKL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgcagcagcccctgaactacccatacccccaaatctactgggtggacagcggggccccc
tccccctggactcctcctccaaggacagtcctcccctgtccctcctcggtgcccggaagg
cccggtcagaggaggccaccgccaccgccaccgccgcaggcaccaccaccccccttgcct
ccactgccactgccaccgctgaagaagaggagagaccacaacacaggcctgtgtctcctt
gtgatgtttttcatgattctggtggccctggtggcgttggggctcgggatgttccagctg
ttaaacctgcagaaggagctggccgagctcagagagtcctccagccaaaggcacatagaa
tcatctttggagaagcaaataggtcaccccagtccaccctctgaaaaagaggagcagagg
aaagtggcccatttgacaggcaagcccaactcaagatccatccctctggaatgggaagac
acctatggaattgccctggtcgccggggtgaagtataagaagggcagccttgtaatcaat
gacactgggctatactttgtgtattccaaagtatacttcagaggtcagtcctgcaagaaa
cagcctctgaaccacaaggtctatatgaggaactctaagtatccccaggacctggtgctg
atggaggagaagatgatggactactgcactgtcggccagatgtgggcccgcagcagctac
ttgggtgcggtgttcaacctcaccagtgctgaccacttacatgttaacgtgtctgaactc
tctctggtcaattttgaggaatctaagacattttttggcttatataagctctaa

DBGET integrated database retrieval system