KEGG   Miniopterus natalensis: 107543962
Entry
107543962         CDS       T05883                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04630  JAK-STAT signaling pathway
mna04640  Hematopoietic cell lineage
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107543962 (IL3RA)
   04151 PI3K-Akt signaling pathway
    107543962 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107543962 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107543962 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107543962 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107543962 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mna04050]
    107543962 (IL3RA)
   04090 CD molecules [BR:mna04090]
    107543962 (IL3RA)
Cytokine receptors [BR:mna04050]
 Interleukin receptor families
  IL3 receptor family
   107543962 (IL3RA)
CD molecules [BR:mna04090]
 Proteins
  107543962 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 107543962
NCBI-ProteinID: XP_016077193
LinkDB
Position
Unknown
AA seq 384 aa
MGTALAMVLLWLPVLLTPISCLLQRDQDPNPPIKNLRMDPRTKSLTWDIHGNVSAIECCI
NSRSNTKAKKNRFCKFYVLPKCKASNYTVKVTTIDGETFSTWIQYPKQEGNPEAAPQNLD
CQVHDKDFLTCSWAVGKEAPSDVQYYFYLENMNTNQKWECSDYTANELGQHIQCQFDDVS
QFSEGQYRFLARGTSNESTVPCSELITFLPDIEKLIAPKITVSCNQSLAFMKWNMSSHFH
KNFDYKLEIQQRSDPPFIQMAPLKNSFMLTNPGTFTVRIRALTILKSPGQWSTPQRFVCD
YEENAFLQIWLTSSLIALATLVTVGTALLLCKRYSVLKMLFPPIPHVKDPTGDNFQDEKM
MAWEDCKRTQQECPVAEVQLLRET
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgggcactgcccttgccatggtcttgctctggctgccggtgctcctgacgcccatctcc
tgtctgctgcaaagggaccaagatccaaacccaccgattaagaacttgaggatggatcca
agaactaagagcttgacctgggacatccacgggaatgtttcggccatagagtgctgcata
aattcaaggtccaacacaaaggccaaaaaaaatcgtttttgcaagttttatgtgcttccc
aagtgcaaagcatccaactacactgttaaagtcactacgattgacggtgagacgttttcc
acgtggatccagtatcccaagcaagaagggaaccctgaggcagccccccagaacctggat
tgccaagttcacgacaaggacttcctgacgtgcagttgggcggtgggcaaggaggccccc
agcgacgtccagtattacttctacttggaaaacatgaataccaaccagaagtgggagtgt
tcagattacacagcgaatgagctggggcaacacatccagtgtcagtttgatgacgtctct
cagttttccgaaggccagtaccgtttcctggcgaggggcaccagcaacgagtccacagtg
ccctgctctgaattaatcacgtttttaccggatatcgagaaattaattgcacccaagata
acagtgagctgcaatcagtctcttgctttcatgaaatggaacatgtcgagccacttccac
aaaaatttcgactacaaacttgaaatacagcagcgctccgatcctcccttcatccagatg
gccccgttgaaaaactccttcatgctgaccaaccctgggaccttcacagtgagaatcaga
gccctgactatattaaaatcacctggacagtggagcaccccccagcgttttgtgtgtgac
tacgaggagaacgcgttcctccagatctggctgacctcgtcgctgatcgcgttggccacg
ctggtcaccgtggggacggcccttctcttatgcaaaaggtactcggtgctgaagatgctg
ttccctcccatccctcatgtgaaggaccccacaggtgacaactttcaggatgagaagatg
atggcctgggaggactgcaaacgcacccaacaagagtgtcccgtagctgaggtgcagctc
ttgagggaaacgtga

DBGET integrated database retrieval system