KEGG   Miniopterus natalensis: 107543970
Entry
107543970         CDS       T05883                                 

Gene name
ANO2
Definition
(RefSeq) anoctamin-2
  KO
K19497  anoctamin-2
Organism
mna  Miniopterus natalensis
Pathway
mna04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107543970 (ANO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107543970 (ANO2)
Ion channels [BR:mna04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107543970 (ANO2)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer DUF3694
Other DBs
NCBI-GeneID: 107543970
NCBI-ProteinID: XP_016077198
LinkDB
Position
Unknown
AA seq 998 aa
MHIPLIPGSARRLSPRTVARGSQGSKQGQQSLQVPGPRAPGLQGSSRRHSGQTGEESSHG
SSVINNYLDANEPVSSEAPLSRMLFHDNQRKVDYVLAYHYRKRGAHPGHGSPGHSLAIIS
NGETGKEPHAGGSRDIELGRLDALEEERKEQREEFESNLMEAGLELEKDVESKSQGSIFV
RIHAPWQVLAREAEFLKIKVPTKKEMYEIKSEGGIAKKFNEILQKLSSPLKPRVPEHRTN
RMKNLSYPFSREKMYLYNIQDKDTFFDNATRSRIVHEILKRTACSRANNTMGINSLIANN
IYEAAYPLHDGEYGGPGDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKIGLYFAWL
GLYTSFLIPSSVIGVIVFLYGCATIEEDIPSKEMCDQQNAFTMCPLCDKSCDYWNLSSAC
GTARASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERAQEHSR
PEYEAKVREKVLNKSDESAVQKLGTNTTECEDEDDDEDKLTWKDRFPGYLINFVSILFMI
ALTFSIVFAVIVYRITTAAALSLNKDTRSNVRVTVTATAVIINLVVILILDEIYGAVAKW
LTQIEIPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFNGYRME
ECAPGGCLMELCIQLSIIMLGKQLIQNNVFEIGVPKLKKLFRKLKDDTEPEETDSAHSKH
PEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRLDAKKFV
TELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSHNGTLHG
FVNHTLSFFNVSQLKEGTQPENSQFDQDVQFCRFKDYREPPWAPNPYEYSKQYWSVLSAR
LAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPVP
SSQGGGHQSSRSRAASPAPSGRSQPGSMGSSGSQHTNV
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgcatattcccctgatccctggctccgcacgcaggctgagccctcggacagtggccagg
ggcagccagggcagcaaacaaggacagcagtccctccaggtgccgggtccccgagcccca
ggtctgcagggcagctcccgccgacattctgggcagaccggtgaagagagctcccatggc
agctccgtcatcaacaactacctggatgccaatgagccagtgtcctcggaggcccctctg
agtcgcatgctcttccatgacaaccaaaggaaggtcgactatgtgctcgcctaccactac
cggaaacgcggggcgcaccccggccacggctcccctggccattcgctggccatcatctcc
aatggggagactggcaaggagccccatgctgggggctctcgtgacattgagctggggcgg
ctggatgccctggaagaggagaggaaggagcagcgggaggagtttgagagcaacctgatg
gaggctgggctggagcttgagaaggatgtggagagtaaaagccaaggatccatctttgtc
cggatacacgccccatggcaggtgctggccagagaggcagaattcttgaagatcaaagtt
cccaccaagaaagagatgtatgagatcaaatcagaagggggcattgcgaagaagttcaac
gagattctgcagaagctgagctcgcccctgaagcccagagttccagagcataggaccaac
aggatgaaaaacctctcctacccattctccagggagaaaatgtacctgtacaacatccag
gataaggacaccttctttgataatgccacccgtagccgcattgtgcatgagatcctgaag
cgcacagcctgttcccgagccaacaacacgatgggtattaactctctgatagcaaacaat
atctacgaggcagcctaccctcttcatgacggtgaatatggtggcccaggggatgacatg
aatgacagaaagctgctgtatcaagaatgggcacgctacggagtattttataagtttcaa
cctattgatctcatcagaaagtattttggagaaaaaatcggactgtattttgcttggctg
ggattatatacatcattcctcatcccatcttctgtaattggcgtgattgtgtttctttat
gggtgtgcaacaattgaagaagatattccaagcaaagagatgtgtgaccagcagaatgcc
ttcactatgtgtcccctgtgtgacaagtcctgtgattactggaacctcagctcagcctgt
ggtacagcacgggccagccacctatttgacaaccctgccaccgtcttcttctctatcttc
atggctctgtgggctaccatgtttctcgaaaactggaagagattacagatgcgactgggc
tacttctgggacctaaccggcatagaagaggaagaagaacgtgcccaggaacattcccgg
cctgagtatgaagccaaagttcgagaaaaagtgttaaataagagtgatgagtcagctgtc
cagaaattggggaccaacacaaccgagtgtgaggatgaggatgatgatgaagataagctg
acctggaaagatcgtttcccaggttacctgataaacttcgtctccatcttgttcatgatt
gccctgactttctccatcgtctttgcggtcattgtgtatcgtatcacaactgcagctgct
ctgtctctcaacaaggacacacgctccaatgtccgggtcacggtgacagcgacagcagtc
atcatcaacctcgtggtcatcctcatcttggatgagatctacggtgctgtggccaagtgg
ctcacccaaatcgagattccaaaaacagaacaaacttttgaagaacgcctgatactgaaa
gctttcttgctaaagtttgtcaatgcctactcgcccatcttctatgtggcctttttcaag
gggaggtttgtgggcagacctggaagctatgtctatgtcttcaatggttaccgcatggaa
gagtgtgctcccgggggctgcctcatggagctctgtattcagctcagcatcatcatgttg
gggaagcagctgatccagaacaacgtctttgagattggagttccgaagttaaagaaacta
tttcggaagctaaaagatgacacagaacctgaggaaactgactctgcgcattcaaagcat
ccagagcagtgggacctagactacagcttggaaccatatactggactgactccagagtac
atggaaatgatcatccagtttggctttgtcaccctctttgtggcctcctttcccctggca
cctgtgtttgccctcctcaacaatgtcattgaagtgcggcttgatgcaaagaagtttgtc
acggagctgagacggccagatgctgtgagaaccaaagatatcgggatttggtttgacatt
ctctccggaattggcaagttctctgttatcagcaatgcttttgtcattgccatcacctcc
gactttatcccccgccttgtataccagtactcctacagtcacaacgggactctgcatggt
tttgtcaaccacaccctctcctttttcaacgtcagccagctgaaggagggaacgcaacct
gaaaactcacagtttgaccaggatgtccagttctgcaggtttaaggattaccgagagcca
ccgtgggccccgaatccatatgagtattccaagcagtactggtctgttctgtctgctcgt
ctggcttttgtcataatcttccagaaccttgtgatgttcctgagcgtcctcgtggactgg
atgatcccagatatccccacagacatcagcgaccagatcaagaaagagaagagcttgttg
gtggacttcttcctgaaagaggaacatgagaagctcaagctgatggatgagccagtgccc
agcagccagggaggcgggcatcagagcagcaggagccgggcggccagccccgctccctca
ggccggagccagccaggcagcatggggtcctccggttctcagcacaccaacgtgtga

DBGET integrated database retrieval system