KEGG   Miniopterus natalensis: 107544013
Entry
107544013         CDS       T05883                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4
  KO
K06454  T-cell surface glycoprotein CD4
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04514  Cell adhesion molecules
mna04612  Antigen processing and presentation
mna04640  Hematopoietic cell lineage
mna04658  Th1 and Th2 cell differentiation
mna04659  Th17 cell differentiation
mna04660  T cell receptor signaling pathway
mna05135  Yersinia infection
mna05166  Human T-cell leukemia virus 1 infection
mna05170  Human immunodeficiency virus 1 infection
mna05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mna05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107544013 (CD4)
   04514 Cell adhesion molecules
    107544013 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107544013 (CD4)
   04612 Antigen processing and presentation
    107544013 (CD4)
   04660 T cell receptor signaling pathway
    107544013 (CD4)
   04658 Th1 and Th2 cell differentiation
    107544013 (CD4)
   04659 Th17 cell differentiation
    107544013 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107544013 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107544013 (CD4)
   05170 Human immunodeficiency virus 1 infection
    107544013 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107544013 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    107544013 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107544013 (CD4)
CD molecules [BR:mna04090]
 Proteins
  107544013 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set Ig_2 ig V-set Tcell_CD4_C P_proprotein DUF4382 DUF2892
Other DBs
NCBI-GeneID: 107544013
NCBI-ProteinID: XP_016077236
LinkDB
Position
Unknown
AA seq 359 aa
MSDSGIYTCEVENKEIQVELLVFRLKVNSGTHSSIRLMRGKSLTLTLESPSGSNPSVKCK
GPGNKEWNVDKSRSLPQLELQDSGTWTCTVSQNAKKLEFKINILVLAFRKISNTFYTKVG
EPVEFSFPLTFEDENLSGELKWQKEGASSLQSWITFSLENKKVSVVNAHQDRKIQLKETL
PLRFSLPQALPQDAGSGNLTLSLSQGQLHQEVNLVVMRMTNSENKLTCEVLGPSSPKLML
SLKLNNQTAKVSNQEKLVTVLDPEVGVWHCLLTDKHKVLLESKVEVLQAGLTQDLPTFLA
IVLGPIGGFLIFTGLCIFCCVKYRHRRRQAERMSQIKRLLSEKKTCHCPHRFQKTCNLI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcagactcagggatttatacctgtgaagtggagaacaaggaaatacaagtggaattg
ctggtgttcagattgaaggtcaattccggcacccacagcagcatccgcctgatgcgaggg
aagagcctgaccctgactttggagagcccctctggtagtaacccttcagtaaaatgtaaa
ggtccagggaataaagagtggaatgtggacaagagccgctcactgccccagctggagttg
caggacagtggtacatggacatgcacggtctcccagaacgcaaagaaactggagttcaag
ataaacatcttggtgctggctttcaggaagatctctaacacattctatacaaaagtaggg
gagcccgtagagttctccttcccacttacttttgaagatgaaaacctgagcggggagctg
aagtggcagaaggagggggcttcctcccttcagtcctggatcaccttctccttggagaac
aagaaggtgtctgtggtgaatgctcaccaagacaggaagatccagctgaaggagacactc
ccgctccgcttcagcctgccccaggccttgcctcaggatgctggttctggaaacctgacc
ctgtctctcagccaggggcagctgcatcaggaagtgaacctcgtggtgatgagaatgact
aattccgagaacaaattgacctgtgaggtgctggggcccagctcccccaaactgatgctg
agcttgaagctgaacaaccagactgcaaaggtctcaaatcaagagaagctggtgacggtg
ttggaccctgaggtgggggtgtggcattgtctacttactgacaagcacaaagtcctgctg
gaatccaaagtcgaggttttgcaagcagggttaacccaggacttgccaacatttctggcc
attgttctggggccaataggaggctttctgattttcaccggactctgcatcttctgttgt
gtcaaataccggcaccgaaggcgccaggcagagcggatgtctcagatcaagagactcctc
agtgagaagaagacctgccattgcccccaccgattccagaagacatgtaatctcatttga

DBGET integrated database retrieval system