KEGG   Miniopterus natalensis: 107544042
Entry
107544042         CDS       T05883                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04022  cGMP-PKG signaling pathway
mna04072  Phospholipase D signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04261  Adrenergic signaling in cardiomyocytes
mna04270  Vascular smooth muscle contraction
mna04371  Apelin signaling pathway
mna04614  Renin-angiotensin system
mna04924  Renin secretion
mna04925  Aldosterone synthesis and secretion
mna04927  Cortisol synthesis and secretion
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna05171  Coronavirus disease - COVID-19
mna05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107544042 (AGTR1)
   04020 Calcium signaling pathway
    107544042 (AGTR1)
   04072 Phospholipase D signaling pathway
    107544042 (AGTR1)
   04022 cGMP-PKG signaling pathway
    107544042 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544042 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107544042 (AGTR1)
   04614 Renin-angiotensin system
    107544042 (AGTR1)
   04925 Aldosterone synthesis and secretion
    107544042 (AGTR1)
   04927 Cortisol synthesis and secretion
    107544042 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107544042 (AGTR1)
   04270 Vascular smooth muscle contraction
    107544042 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544042 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107544042 (AGTR1)
   04934 Cushing syndrome
    107544042 (AGTR1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107544042 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544042 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107544042 (AGTR1)
Membrane trafficking [BR:mna04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107544042 (AGTR1)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Angiotensin
    107544042 (AGTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107544042
NCBI-ProteinID: XP_016077272
LinkDB
Position
Unknown
AA seq 359 aa
MILNSSTDDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCITIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYELQNSTLPAGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKSKQRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIINDCKITDIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNGNSSTKKPAPCVEVE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatcctcaactcttccactgacgatggtattaaaagaatccaagatgactgtcccaaa
gctggacggcacaattacatatttgtcatgatccctactttatacagcatcatctttgtg
gtgggaatatttggaaacagcttggtggtgattgtcatttacttttacatgaaactgaag
accgtggccagtgtctttctcttgaatttagcgctggctgacttatgctttttactgact
ttgccactgtgggccgtctacactgctatggaataccgctggcccttcggcaattacctg
tgtaagatcgcgtcggccagtgtcagcttcaacctctatgccagtgtgtttctactcacg
tgtctgagcatcgatcgctacctggctatcgttcacccaatgaagtcccgccttcggcgc
acaatgcttgtggccaaagtcacctgcatcactatctggctgctggctggcttggccagt
ttgccaactatcatccaccgaaacgtgtttttcattgagaacaccaacatcacagtgtgt
gctttccattacgaactccaaaattcaaccctccccgcagggctgggcctgaccaagaat
attctgggtttcctgtttccttttctcatcattcttacaagttacactcttatttggaag
gccctaaagaaggcttatgaaattcagaagagcaagcagagaaatgatgatattttcaag
ataatcatggcaattgtgcttttctttttcttctcctgggttccccatcaaattttcact
ttcctggatgttctgattcagctgggcatcataaatgactgtaaaatcacagatattgtt
gacaccgccatgcccatcactatctgcatagcttattttaacaactgcctcaatcctctc
ttctatggctttcttgggaaaaaatttaaaaaatattttctccagcttctgaagtacatc
cctccaaaggccaagtcccactccagtctatccacaaaaatgagcacgctttcctaccgc
ccctcggataatggaaactcatccaccaagaagcctgccccgtgcgttgaggttgagtaa

DBGET integrated database retrieval system