KEGG   Miniopterus natalensis: 107544244
Entry
107544244         CDS       T05883                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mna  Miniopterus natalensis
Pathway
mna00590  Arachidonic acid metabolism
mna01100  Metabolic pathways
mna01523  Antifolate resistance
mna04726  Serotonergic synapse
mna04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107544244 (ALOX12)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107544244 (ALOX12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107544244 (ALOX12)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107544244 (ALOX12)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     107544244 (ALOX12)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 107544244
NCBI-ProteinID: XP_016077550
LinkDB
Position
Unknown
AA seq 755 aa
MGRYRVRVATGAWLFSGSLNRVQLWLVGERGEAELELRLRPARGQGDGPPRARARGERSQ
RTGQVTRLRVQPKTLGPRPASLVLSVRWGVGDPPAGVGRRRRRPWRPRHLTPQRTPHPQQ
TSPPGSPLLSVTGSWSPQVEEFEHDVPEDLGPLQFVKLRKHHSLVDDAWFCDRITVQGPG
AGEEAAFPCYRWVQGEGVMSLPEGTARLAGDNALDVFQKHREKELKERRQIYCWATWKEG
LPLTIAAGSEDDLPPNARFHKEKKLDFETTLRAGILEIALKRVYTLLSSWNHLEDFDQIF
WGQKSTLAEKVQQRWQDDELFGYQFLNGANPMLLRRSTSLPSRLVLPSGMEELGAQLEKE
LQKGSLFEADFILLDGIPANVIQGEQQYLAAPLVMLRMEPSGKLLPMVIQIQPPNPSFPT
PPLFLPSDPPLAWLLAKSWVRSSDFQLHELRYHLLNTHLVAEVIAVATMRCLPGLHPVFK
LLIPHIRYTMEINTRGRTQLISDGGIFDKAVSTGGGGHVQLMRRAMAQLTYRSLCAPDDL
ADRGLLGIPSALYAHDALRLWDXIRYVEGIIHLFYHGDDIVRGDPELQAWCQEITEVGLC
QAQDRGFPVSFQSLNQLCHFLTMCVFTCTAQHGAINKGQLDWFAWVPNAPCTMRMPPPTT
KEDVTMATVMGSLPDVQQACLQMAITWHLGRRQPDMVPLGHHKEMYFSGSKAKAVLNQFQ
TDLENLEREITARNEQLGLAYEYLKPSHIENSITI
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgggccgctaccgcgtccgggtggccaccggcgcctggctcttctcggggtcgctgaac
cgcgtgcagctgtggctggtcggggagcgcggggaggcggagctggagctgcggctgcgg
ccggcgcggggccagggggacggtcccccgagggcgcgggcgcggggagagcgcagccag
cggacggggcaggtgacgaggctccgggttcaacccaagaccctggggcctcgccccgcg
tccctcgtcctctcggtgcgatggggcgtcggagacccgcccgcaggtgttgggaggagg
cggcgccgtccttggaggcctcgtcacctgactccacaaaggaccccgcacccccagcag
acgtcccctcctgggtccccgctactgagtgtcacggggtcctggtccccacaggtggag
gagtttgagcacgatgtccccgaggacctggggccactgcagttcgtgaagttgcgcaaa
caccactccctggtggacgacgcgtggttctgcgaccgcatcacggtgcagggcccaggc
gcgggcgaggaggccgccttcccctgctaccgctgggtgcagggcgagggcgtgatgagc
ctgcccgagggcacagcccgcctggcaggagacaatgcattggatgtgttccagaaacat
cgagagaaggaactgaaagaaagacgacaaatatactgctgggccacctggaaggaaggg
ctacccctgacaatagctgcaggcagtgaggatgatctacctccaaatgcaagattccac
aaggagaagaaactggactttgaaacgacactgagggcagggattctggagattgccctc
aagcgtgtttacaccctcctgagctcctggaaccatctggaggattttgatcagatcttc
tggggccagaagagcactctggctgagaaggttcagcagcgctggcaggatgatgagctc
tttggctaccagttcctcaatggcgccaaccccatgctgctgagacgctccacctctctg
ccctcccggctggtgctgccctcggggatggaggagcttggggcccagttggagaaagaa
ctccagaagggttccctgtttgaggctgacttcatcctgctggatggaattccagccaat
gtgatccaaggagagcagcagtacctggctgcccccctcgtcatgctgaggatggagccc
agtgggaagctgctgcccatggtcatccagatccagcctcccaaccccagctttccaacc
ccaccactgttcctgccctcagatcctccacttgcttggctcctggcaaagtcctgggtc
cgaagttcagatttccaactgcacgagctccgataccatcttctgaacactcatctggta
gctgaagtgatcgctgtggccaccatgaggtgcctcccaggactgcaccctgtcttcaag
ctcctgatcccacacatccgctacaccatggagatcaacacacggggtcggacccaactc
atctcagatggaggtatatttgataaggcagtgagcacaggtggagggggccatgtgcag
ttgatgcgtcgggccatggctcagctgacctaccgctccctctgtgctcctgacgatctg
gctgaccgcggcctgctgggaatcccaagtgccctctatgcccatgatgctctacggctc
tgggacncgatcaggtacgtggaagggatcattcacctcttctaccatggcgatgacatc
gtgagaggggaccctgagctgcaggcctggtgtcaggagatcactgaggtggggctgtgc
caggcccaggaccgaggtttccctgtctccttccagtctctgaatcaactctgccacttc
cttaccatgtgtgtgttcacatgcactgcccagcatggggccatcaacaagggccagctg
gactggtttgcctgggtccctaatgccccatgcacaatgcgaatgcccccaccgaccacc
aaagaagatgtgacaatggccacagtgatgggctcactacctgatgtccaacaggcatgt
cttcaaatggccatcacatggcatctgggtcgacgccagccagacatggtacctctgggg
catcacaaagaaatgtatttctcaggctccaaggccaaggctgtactaaaccaattccaa
acagatctggaaaacttggaaagggaaattacagcccggaatgagcaacttggcttagcc
tacgaatacttaaagcccagccacatagagaacagtatcactatctga

DBGET integrated database retrieval system