KEGG   Miniopterus natalensis: 107544281
Entry
107544281         CDS       T05883                                 

Gene name
LHCGR
Definition
(RefSeq) lutropin-choriogonadotropic hormone receptor
  KO
K04248  lutropin-choriogonadotropic hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04913  Ovarian steroidogenesis
mna04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107544281 (LHCGR)
   04024 cAMP signaling pathway
    107544281 (LHCGR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544281 (LHCGR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107544281 (LHCGR)
   04917 Prolactin signaling pathway
    107544281 (LHCGR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Lutropin-choriogonadotropic hormone
    107544281 (LHCGR)
SSDB
Motif
Pfam: 7tm_1 LRR_8 LRR_5 Comm
Other DBs
NCBI-GeneID: 107544281
NCBI-ProteinID: XP_016077602
LinkDB
Position
Unknown
AA seq 685 aa
MSTTNGQERWESEGQPRHKPGSDFLRVRQLRDDLSLQARTPWRSLTYLPIKVIPSQAFRG
LNEVVKIEISQSDSLEKIEANAFDNLLNLSEILIQNTKNLVHIEPAAFTNLPRLKYLSIC
NTGIQKLPDVTKIFSSEFNFILEICDNLHITTIPGNAFQGMSNESVTLKLYGNGFEEIQS
HAFNGTTLISLELKENEHLKKMHHGAFQGATGPSILDISSTKLQALPGYGLESVQTLIAT
SSYSLKKLPAREKFTNLLDAVWTYPSHCCAFRNLPTREQSFSFSIFENFSKQCESTARKP
NNETLYSAIFAESELSGWDYDYGFCSPKTVRCAPEPDAFNPCEDIMGYDFLRVLIWLINI
LAIVGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDFQTKGQYYNHAI
DWQTGSGCSAAGFFTVFASELSVYTLTVITLERWHTITYAVQLDQKLRLRHAIPIMLGGW
LFSTLIAMLPLVGVSSYMKVSICLPMDVETTVSQVYILTILILNVVAFIIICACYIKIYF
AVQNPELKATNKDTRIAKKMAVLIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVFF
YPVNSCANPFLYAIFTKAFQRDFFLLLSKFGCCKRRAELFRRKDFSAYTSNCKNGFTGPN
KPSQATLKLTTLHCQYTVDKTCCKE
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagcaccacgaatgggcaggagcggtgggagagcgagggtcagcccaggcacaagcca
gggtcggatttcctgagggtcagacagttgagagatgacctcagccttcaggccaggacc
ccatggagatcactcacctatctccctatcaaagtaattccatctcaagctttcagagga
cttaatgaggtcgtaaaaattgaaatttctcagagcgattccctggaaaagatagaagct
aatgcctttgacaacctcctcaatttgtctgaaatactgatccagaacaccaaaaacctg
gtacatatcgagcctgcagcatttacgaatcttccccggttaaaatacctgagcatctgc
aacactggcattcaaaagcttccagatgttacaaagatcttctcctctgaatttaatttc
attctggaaatttgtgataacttacacataaccaccataccggggaacgctttccaaggg
atgagtaacgagtccgtaacgctcaaactgtacggaaatggatttgaagaaatacaaagt
catgcgttcaacgggacgacgctgatttccctggagctaaaggagaacgaacacctgaag
aagatgcaccatggagccttccagggggccacggggcccagcatcttggatatttcttcc
accaaactgcaggccctgcctggctatgggctggagtccgttcagacgctaattgccacc
tcatcctactccctgaaaaagttgccagcaagagaaaaatttaccaatctcctggatgcc
gtatggacttaccccagccactgctgtgcttttagaaacttgccaacaagagagcagagt
ttttcattttccatttttgaaaacttttccaaacaatgtgaaagcacagcaaggaaacca
aataatgaaacactttattctgccatctttgctgagagtgaactgagtggctgggattat
gactatggtttctgctcacccaagacagtccgatgtgctcctgaaccagatgcttttaat
ccctgtgaagatatcatgggctatgacttccttagggtcctgatttggctgatcaatatc
ctagccatcgtgggaaacatgactgtcctctttgttctcctgaccagtcgttataaactg
acagtgccccgttttctcatgtgcaatctctcctttgcagacttttgcatggggctctat
ctgctgctcattgcctccgtcgatttccaaaccaaaggccagtattataaccatgccata
gactggcagacgggaagtgggtgtagcgctgccggctttttcactgtatttgcaagtgaa
ctttctgtctacaccctcacagtcatcacactagaaagatggcacaccatcacctatgct
gttcagctggaccaaaagctacgattaaggcacgccattccgattatgcttggaggatgg
ctcttttctacgctaattgccatgttgccccttgtgggtgtcagcagttacatgaaggtc
agcatttgcctccccatggatgtggaaaccactgtctcacaagtctacatattaaccatt
ctgatactcaatgtggtggccttcatcatcatttgtgcttgctacattaaaatttatttt
gcagttcaaaatccagagctgaaggctaccaacaaagacacaaggattgctaagaaaatg
gcagtcctcatcttcaccgacttcacctgcatggcacctatctctttttttgccatctca
gctgccttcaaagtgccccttatcacagtaaccaactcaaaagttttactggtgtttttt
tatccggtcaattcttgtgccaatccatttctgtacgcgattttcacaaaggcattccaa
agggatttctttctgttgctgagcaaatttggctgctgtaaacgtcgggctgaacttttt
agaaggaaagatttttcagcttatacatccaactgcaaaaatggcttcactggcccaaat
aagccttcccaggccactctgaagctgaccacgttgcactgtcaatatacagttgacaaa
acttgctgtaaagagtga

DBGET integrated database retrieval system