KEGG   Miniopterus natalensis: 107544288
Entry
107544288         CDS       T05883                                 

Gene name
FSHR
Definition
(RefSeq) follicle-stimulating hormone receptor isoform X1
  KO
K04247  follicle stimulating hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107544288 (FSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544288 (FSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107544288 (FSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107544288 (FSHR)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Peptide
   Follicle stimulating hormone (FSH)
    107544288 (FSHR)
SSDB
Motif
Pfam: 7tm_1 GnHR_trans LRR_8 LRR_5 LRRNT LRR_4 LRR_9
Other DBs
NCBI-GeneID: 107544288
NCBI-ProteinID: XP_016077607
LinkDB
Position
Unknown
AA seq 694 aa
MALLLVSLLAFLSLGSGCPHRICHCSHRVFLCRDSEVKEIPSDLPRNAVELRFVLTKLQV
IPKGAFSGFGDLEKIEISQNDVLEVIEANTFSNLPRLHEIRIEKANNLLYIDPDAFQNLP
NLRYLLISNTGIKRLPTVHRIQSLQKVLLDIQDNINIHTVERNSFVGLSFESMILWLSKN
GIEEIHSCAFNGTQLDELNLSDNNNLEELPNDVFQGASGPVILDISRTKIHSLPSYGLGN
LKKLRARSTYNLKKLPSLEKFVELMEASLTYPSHCCAFANWRQQISVLHPICNKSNLRQE
VDYMTHARGQRVSLAEDESSSAKGFDMMYSEFDYGLCNEVVDVTCSPKPDAFNPCEDIMG
YDILRILIWFISILAITGNILVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIASV
DIHTKSQYHNYAIDWQTGVGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECRV
QLRHAASVMLVGWIFAFVAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVLA
FVVICGCYTHIYLTVRNPNIVSSSSDTKIAKRMAVLIFTDFLCMAPISFFAISASLKVPL
ITVSNSKILLVLFYPINSCANPFLYAIFTKNFRRDFFILLSKFGCFEMQAQIYKTETSSS
AHNSHPRNGHCPKVPRVTNGSNYTLVPLSHLAQK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggccttgctcctggtctccttgctggctttcctgagcttgggctcgggatgtccccat
cggatctgccactgctctcacagggttttcctctgccgagacagcgaggtgaaggagatt
ccctccgaccttcccaggaatgcggttgaactgaggtttgtcctcaccaagcttcaagtc
atcccaaaaggagcgttttcgggatttggggacctggagaaaatagagatctcgcagaat
gatgtcttggaagtgatagaggcgaacacgttctccaacctgcccagattacatgaaatt
agaattgaaaaggccaacaacctgctatacatcgaccccgatgccttccagaacctgccc
aacctccgatatttgctaatatccaacacaggtattaagcgcttgccaactgttcacagg
attcagtctctccaaaaggttctactagacattcaagacaatataaacatccacacggtg
gagagaaattctttcgtgggactgagctttgaaagcatgattctctggctgagtaagaat
gggattgaagaaatacacagctgtgcattcaatggaacccaactagatgagctgaatcta
agtgataacaataatttggaagaattgcctaatgatgttttccagggagcctctggacca
gtcattctagatatttcaagaaccaagatccattccctgcctagctatggcttaggaaac
cttaagaagctgcgggccaggtcgacttacaatttaaaaaagcttcccagtctggaaaag
tttgttgagctcatggaggccagcctcacctaccccagccactgctgcgcatttgcaaac
tggagacagcaaatctctgtgcttcatccaatttgcaacaaatctaatttaaggcaagaa
gttgattatatgactcacgctaggggtcagagagtctctttggcagaagatgagtccagt
tccgccaaaggatttgacatgatgtacagtgaatttgactatggcttatgcaatgaggta
gttgatgtgacttgctctcctaagccagatgcattcaatccatgtgaagatatcatgggg
tatgatattctcagaatcttgatatggtttattagcatcctggccatcactgggaacatc
ctagtgctggtgattctgattaccagccaatacaaactcactgtcccccggttccttatg
tgcaacctggcctttgccgatctctgcattggaatctacctgctgctcatagcatctgtt
gacatccacaccaaaagccagtaccacaactatgccattgactggcaaactggagtgggc
tgtgatgctgctggctttttcaccgtcttcgccagtgagctctcagtctacacactaaca
gccatcactctggaaaggtggcacaccatcacccatgccatgcagctggaatgtagggtg
cagctccgccatgctgccagtgtcatgctggtaggctggatctttgcttttgtggccgcc
ctctttcccatctttggcattagcagctacatgaaggtgagcatctgcctgcccatggat
atcgacagccccttgtcacagctgtatgttatgtccctccttgtgctcaatgtgctggcc
tttgtggttatctgtggctgctacactcacatctacctcacagtgaggaaccccaacatc
gtgtcctcctctagtgataccaagatcgccaagcgcatggccgtgctcatcttcacggac
ttcctctgcatggcacccatctccttctttgccatctctgcctccctcaaggtgcccctc
attactgtgtccaattcaaagatcctcctggtcctgttctaccccatcaattcctgtgca
aaccccttcctctatgctatcttcaccaagaacttccgcagagatttcttcatcctgctg
agcaagtttggctgctttgaaatgcaagcccagatttacaagacagaaacctcatccagt
gcccacaattcccatccaaggaatggccactgcccgaaagttcccagggttaccaatggt
tccaattacacacttgttcctctaagccatttagcccagaaataa

DBGET integrated database retrieval system