KEGG   Miniopterus natalensis: 107544308
Entry
107544308         CDS       T05883                                 

Gene name
CALD1
Definition
(RefSeq) caldesmon isoform X1
  KO
K12327  caldesmon
Organism
mna  Miniopterus natalensis
Pathway
mna04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107544308 (CALD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mna04812]
    107544308 (CALD1)
Cytoskeleton proteins [BR:mna04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107544308 (CALD1)
SSDB
Motif
Pfam: Caldesmon
Other DBs
NCBI-GeneID: 107544308
NCBI-ProteinID: XP_016077647
LinkDB
Position
Unknown
AA seq 534 aa
MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEEALG
QGTDQVEAHAQNSVPDEEGKATTMNTQVEGDEEAALLERLARREERRQKRLQEALERQKE
LDPTVTDVGVSLPSGRMGNDTAENENTEKEEKLERRQERYAMEETETVPKACQKNARRDA
EDRNEEAREKDEAEKPKRGSVKENQFKDEKIKKDKEPREEVKSFLDGKKGFTEVKSQNGE
FMTHKLKHTENSFSRPGGRALEAKEAEGAPQVEAGRRLEELRRRRGETESEEFEKLRQKQ
QEAALELEELKKKREERRKVLEEEEQRRKQEEAERKAREEEEKRRLKEEIERRRAEAAEK
RQKMPEDGLADDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSGVKSTHQAAVVSKIDSRL
EQYTSAIEGTKTAKPAKPAASDLPVPAEGVRNIKSMWEKGNVFSSPSASGTPNKETAGLK
VGVSSRINEWLTKTPDGNRSPAPKPSDLRPGDVSGKRNLWEKQSVDKVTSPTKV
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggatgactttgaacgtcgcagagaactcaggaggcaaaagcgggaagagatgcgcctg
gaagcagaaaggatcgcctaccagaggaacgacgacgatgaggaagaggccgcgagggag
cggcgccggcgagcccggcaggagaggctgcggcagaagcaggaggaagaggccctgggg
caggggaccgaccaggtggaggctcacgcccagaacagtgtgcccgacgaggagggcaag
gccaccaccatgaacactcaggtggagggcgatgaagaggccgcgctcctggagcgcctg
gctcggcgggaggagagacgccaaaagcgccttcaggaagccctggagcggcagaaggag
ctggaccccacagtgacagatgtcggcgtgtcgctgcccagcgggagaatggggaacgac
acagcagaaaacgaaaacaccgagaaggaggaaaagctcgaacgtcgccaggaaagatac
gcgatggaggagactgaaacggtgcccaaggcctgccagaagaacgcccggagggatgcc
gaagacagaaatgaagaggcccgagaaaaagacgaagcagagaagccaaagcgagggagc
gtcaaggaaaatcagttcaaagatgagaagattaaaaaagacaaagagcccagagaagaa
gtgaagagcttcttggatggaaagaagggatttacagaagtgaagtcgcagaatggagaa
ttcatgacccacaaacttaagcacaccgagaattctttcagccggcctggagggagggcc
ctggaggccaaggaggcagaaggggcgccccaagtggaggcgggcaggcgcctggaggag
ctgcgccgccggcgcggggaaaccgagagcgaggagttcgagaagctccggcagaagcag
caggaggcggccctggagctggaggagctgaagaagaagagggaggagcgaaggaaggtc
ctggaggaggaagagcagaggcggaaacaggaggaagccgagcggaaagcccgagaggag
gaagagaagaggagactaaaggaagagattgaaaggcgaagggcagaagctgctgagaaa
cggcagaagatgccagaagacggcttagctgatgacaagaagcctttcaagtgtttcact
cctaaaggttcatctctcaagatagaagagcgagcagaatttttgaataagtctgtgcag
aaaagtggtgtcaagtcaactcatcaagcggcggttgtctccaagatcgacagcaggctg
gagcagtacaccagtgccattgagggaacaaaaactgcaaaacctgcaaagccagcagcc
tcggacctccctgttcctgccgaaggcgttcgcaatatcaagagcatgtgggagaagggg
aatgtgttttcatcccccagcgcatcgggcacaccaaacaaggaaactgctggcttgaag
gtgggggtttccagccgcatcaatgagtggctaaccaaaaccccagatggaaaccggtca
cctgctcccaaaccttctgatttgaggccaggggacgtctctggcaagcggaacctctgg
gaaaagcaatccgtggacaaggtcacatcccccactaaggtttga

DBGET integrated database retrieval system