KEGG   Miniopterus natalensis: 107544316
Entry
107544316         CDS       T05883                                 

Gene name
MSH2
Definition
(RefSeq) DNA mismatch repair protein Msh2 isoform X1
  KO
K08735  DNA mismatch repair protein MSH2
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna03430  Mismatch repair
mna05200  Pathways in cancer
mna05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    107544316 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107544316 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107544316 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107544316 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mna03400]
    107544316 (MSH2)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     107544316 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV AAA_27 ArdA
Other DBs
NCBI-GeneID: 107544316
NCBI-ProteinID: XP_016077655
LinkDB
Position
Unknown
AA seq 934 aa
MAVQPKETLQLESAAEYGFVRFFQSMPEKPTTTVRLFDRGDFYTAHGEDALLAVREVFKT
QGVIKYMGPAGAKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
FKASPGNLAQFEDILFGNNDMSASIGAVGVKVSTVDGQRQVGVGYVDSMQRKLGLCEFPD
NDQFSNLEALMIQIGPKECVLPGGETAGDMGKLRQVIQRGGILITERKRVDFSAKDIYQD
LNRLLKGKKGEQVNSAVLPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFRQYM
KLDIAAVRALNLFQGSVEDTTGSQSLTALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERL
NLVEAFVEDAELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQA
LEKYEGKHQTLLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSE
LREIMDGLEKKMQSTLISTARDLGLESGKQIKLDSNSQFGYYFRVTCKEEKVLRNNKNFS
TIDIQKNGVKFTNRALTSLNEEYTKNKIEYEEAQNAIVKEIVNISSGYVEPMQTLNDVLA
QLDAVVSFAHVSNGAPVPYVRPVILEKGEGRIILKASRHACVEVQDEVAFIPNDVHFEKD
KQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMF
ATHFHELTALASQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHV
IECAKQKALELEEFQNIGVSQENDEMEPAAKRCYLEREQGEKIIQEFLSKVKQIPFTEMS
EENVMMKLKQLKAEVIAKNNGFVNEIISRIKVTT
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggcggtgcagccgaaggagacgttgcagctggagagcgcggcggagtatggctttgtg
cgcttcttccagagcatgccggagaagccgaccaccacggtgcgcctcttcgaccgcggc
gacttctacacggcgcacggcgaggacgcgctgctggccgtccgggaggtgttcaagacg
cagggcgtgatcaagtacatggggccggcaggagcaaagaccctggagagtgttgtgctt
agtaaaatgaattttgagtcctttgtaaaagatcttcttctagttcgtcagtacagagtt
gaagtttataagaatagagctggaaataaggcttccaaggaaaatgattggtatttggca
tttaaggcttctcccggtaatcttgctcagtttgaagatattctcttcggtaacaatgat
atgtcagcttctattggtgctgtgggtgttaaagtgtctacagttgatggccaaagacag
gtcggagttgggtatgttgactccatgcaaaggaagctaggactgtgtgaattccctgat
aatgatcagttctccaatctggaggctctcatgattcagattggaccaaaggaatgtgtt
ttacctggaggagagactgctggagacatgggaaaactgaggcaggtcattcagagagga
ggaattctaatcacagaaagaaagagagttgacttttccgcaaaagatatttatcaggac
cttaaccggttgttgaaaggcaaaaagggagaacaggtgaatagtgctgtcttgccagaa
atggagaatcaggttgcagtttcatcattgtctgcagttatcaagtttttagaactctta
tcagatgattcaaactttggacagtttgaactgactacttttgacttccgccagtacatg
aaattggatattgcagcagtcagagcccttaacctttttcagggttctgttgaagatacc
actggctctcagtctctgactgcattgctgaataaatgcaaaaccccacaaggacaaaga
ctggttaaccagtggattaagcagcctctcatggataagaacagaatagaagagagatta
aatctagtggaagcttttgtagaagatgcagaattgagacagagtttacaagaagattta
cttcgtcgattcccagatcttaaccgacttgccaagaaatttcaaagacaagcagcaaac
ttacaagattgttaccgactctatcagggtataaatcaactccctaatgttatacaggct
ctggaaaaatatgaaggaaaacatcagacattgttgttggcagtttttgtgactcctctt
attgatcttcggtctgatttctccaagtttcaggaaatgatagaaacaactttagatatg
gatcaggtggaaaaccatgaattccttgtaaaaccttcatttgatcctaatctgagtgaa
ttaagagaaataatggatggtttagaaaagaagatgcaatcaacattaataagtacagct
agagatttaggtttggaatctggcaaacagattaaattggattccaattcacagtttgga
tattattttcgggtaacgtgtaaggaagaaaaagtccttcgtaacaataaaaacttcagt
accatagacatccagaagaatggtgttaaatttaccaatagggctttgacttctcttaat
gaagaatataccaaaaataaaattgagtacgaggaagcccagaatgccattgttaaagaa
attgtcaatatttcttcaggctatgtagaaccgatgcagacactcaatgacgtgttagct
cagctagatgctgttgtcagctttgctcatgtgtccaatggagcacctgttccatatgta
cgacccgtcattttggagaaaggagaaggaagaattattttgaaagcatccagacatgct
tgtgttgaagttcaagatgaagttgcatttattcccaatgatgttcactttgaaaaagat
aaacagatgtttcacatcattactggccccaatatgggaggtaaatcaacatatattcgc
caaactggggtgattgttctcatggcccaaattgggtgttttgtgccatgtgagtcggca
gaagtatccattgtggactgtatcttggctcgggtaggggctggtgacagtcagttgaaa
ggagtctccaccttcatggctgaaatgttagaaactgcttctattctcaggtctgcaacc
aaagattctttaataattatagatgaattgggaagaggaacctctacctatgatggattt
gggttagcatgggccatatcagagtacattgcaacaaaaatcggtgctttttgcatgttt
gcaacccattttcatgaacttactgccttggccagtcagataccaactgttaacaatctg
catgtcacagcactaactactgaagaaaccttaactatgctttatcaggtgaagaaaggt
gtctgtgatcaaagttttgggattcatgttgcagagcttgctaattttcctaggcatgta
atagagtgtgctaaacaaaaagccctggaactagaggagtttcagaatatcggagtatca
caagaaaatgatgaaatggaaccagcagcaaagaggtgctatctggaaagagagcaaggc
gaaaaaattattcaagagtttttatccaaggtgaagcaaataccttttactgaaatgtcg
gaagaaaatgttatgatgaagttaaaacagctgaaagctgaggtgatagcgaagaataac
gggtttgtaaatgaaatcatttcacgaataaaggttactacgtga

DBGET integrated database retrieval system