KEGG   Miniopterus natalensis: 107544385
Entry
107544385         CDS       T05883                                 

Gene name
GHRHR
Definition
(RefSeq) growth hormone-releasing hormone receptor
  KO
K04584  growth hormone releasing hormone receptor
Organism
mna  Miniopterus natalensis
Pathway
mna04080  Neuroactive ligand-receptor interaction
mna04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107544385 (GHRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107544385 (GHRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107544385 (GHRHR)
G protein-coupled receptors [BR:mna04030]
 Secretin receptor family
  Hypothalamic hormone
   Growth hormone-releasing hormone (GHRH)
    107544385 (GHRHR)
SSDB
Motif
Pfam: 7tm_2 HRM Tiam_CC_Ex
Other DBs
NCBI-GeneID: 107544385
NCBI-ProteinID: XP_016077742
LinkDB
Position
Unknown
AA seq 423 aa
MDSRTWGACILCLLSPLPIVLGHVHPECDLITRLREDESACLQAAEGMPNITLGCPGTWD
GLLCWPTAGPGEWVTLPCPAFFSYFSSEPGTVKRDCTVVGWSEPFPPYPVACPVPLELLT
EEKSYFSTVKIIYTLGHSISIVALLVAIAILVALRRLHCPRNYIHTQLFTTFILKAGAVI
LKDTTLLHGENTDHCSLSTVLCKVSVATCHFATMTNFSWLLAEAVYLTCLLASTLPSTRR
TFWWLVLASWGFPLLFTGTWVGCKLAFEDAACWDLNDSSPYWWIIKGPIVFSVGVNFGLF
LNIIRILLRKLEPAQGSLHTQSQYWRLSKSTLLLIPLFGIHYIVFNFLPDSAGLGIRLPL
ELGLGSFQGFIVATLYCFLNQEVRTELSRRWHGHNPELLPARRTHARWTVPFRSGTKVLT
SVC
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggacagcaggacgtggggggcctgtatcctctgcctactgagcccattaccaattgta
ctgggccacgtgcacccggagtgtgacttgatcacccggctgagagaggatgagagtgcg
tgtctgcaagcagcagaggggatgcccaacatcaccctgggctgccccgggacctgggac
gggctgctgtgctggcccacggcgggccctggcgagtgggtgactctcccctgcccagcc
ttcttctcttacttcagctcggagcccggcacagtgaagcgggattgcaccgtcgtgggc
tggtccgagcccttcccgccctatcctgtggcctgcccggtgcccctggagctgctgaca
gaagagaaatcttacttctccacggtgaagatcatctacaccctgggccacagcatctcg
atcgtggccctcctggtggccattgccatcctggttgctctcaggaggctccactgcccc
cggaactacatccacactcagctgttcaccaccttcatcctcaaggccggggccgtgatc
ctaaaggacaccaccctcctccacggcgagaacacggaccactgcagcctctccactgtt
ctgtgcaaggtctctgtagccacctgccacttcgccaccatgaccaacttcagctggctg
ttggcagaagctgtctacttgacctgcctcttggcctccacgttgcccagcaccaggaga
accttctggtggctggttctcgctagctgggggtttcccctgctcttcactggcacatgg
gtgggttgcaagttggccttcgaggatgctgcgtgctgggacctgaacgacagctccccc
tactggtggatcatcaaagggcccatcgtcttctctgttggggtgaactttgggcttttt
ctcaatattattcgcatcctgctgaggaaactggagccagctcagggcagcctccacacc
cagtctcagtactggcgcctctctaagtcaacccttctcctcatcccgctgtttggaatc
cactacatcgtcttcaacttcctgcccgacagcgctggcctgggcatccgcctccccctg
gagctggggctgggctcctttcagggcttcattgttgccactctgtattgcttcctcaac
caagaggtgaggactgagctctcacggagatggcatggccacaaccctgagcttctgcca
gcccggaggactcacgccaggtggacagtgcccttccgctcagggactaaggtgctgaca
tctgtgtgctag

DBGET integrated database retrieval system